KEGG   Gamma proteobacterium HdN1: HDN1F_06410Help
Entry
HDN1F_06410       CDS       T01300                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gpb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:gpb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786630..787904
Genome map
AA seq 424 aa AA seqDB search
MDKLLISGGNALSGEVRISGSKNSSLPILAGTLLVDGKAKVSNIPHLHDVTTMIELLGQM
GVDVVVDDHMVLEVDPRGLKDCTAPYELVKTMRASILVLGPLVARFGEAIVSLPGGCAIG
SRPVDLHLKGLEAMGANINVANGYIHATVKGRLKGAHLMLDTVTVTGTENLMMAASLANG
RTIIENAAREPEIVDLANFINAMGGNVQGAGSDTLVIEGVERLQSCEHTVIADRIETGTF
LVAGAITSGLVKCRNTDPRMLDTTLIKLEEAGANISTGADWIEIDMRNRRPRAVNIRTMP
HPGFPTDMQAQFMALNTIAEGTSTITETIFENRFMHVSELARMGADIHVEGNTAVVRGVE
SLTAAPVMATDLRASASLVIAALVAKGETLVDRIYHIDRGYECIEEKLQSLGAKIHRIPS
KRGS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataagctactgatttccggtggaaacgcgctctccggcgaggtgcgtatttccggt
tccaagaactcatcgcttccgattctggcaggcaccttgctggtagacggaaaggcgaag
gtcagcaatatcccgcatcttcacgatgtgaccaccatgattgaactgcttgggcaaatg
ggcgtcgacgtcgttgtcgatgatcacatggtgcttgaagtcgacccgcgcggcctcaaa
gattgcacagcgccgtatgaactcgtcaaaaccatgcgcgcgtccatactggtgcttggc
ccactcgtcgcacgctttggtgaggccatcgtctcgctacccggcggttgtgcgattggc
agcaggccggtcgatttgcacctcaaagggcttgaagccatgggggctaatatcaacgtt
gccaacggctatatccatgcgacggtaaagggccgcctcaaaggcgcgcacctgatgctg
gatacggtcaccgtcaccggcaccgaaaacctgatgatggcggcgtcgctggcaaatggg
cgaaccatcatcgagaacgcagcgcgtgagcccgaaatcgtagacctcgctaatttcatc
aacgcaatgggcggaaacgtccaaggcgccggcagcgatacgctcgtcatcgaaggggta
gagcgcctacaatcgtgcgaacacacggtcattgctgatcgtatcgaaaccggcactttc
ctagtcgctggagcgattacctcgggcctcgtaaaatgtcgcaataccgacccacgcatg
ctcgataccactttgatcaagttagaagaagccggcgcgaacatctccacgggtgcagac
tggattgaaattgatatgcgcaatcgccgcccgcgagcggtgaatattcgcaccatgccg
caccctggtttccctaccgatatgcaggcgcagttcatggcgctcaacaccatcgcggaa
ggcacctcgaccattaccgagacgatctttgaaaatcgcttcatgcacgtctcggaactc
gcacgcatgggcgcagatatccacgtcgaaggcaacaccgccgttgtgcgcggcgtagag
tcgctgaccgccgcgccggtcatggccaccgacctgcgcgcatcggcgagcttagtgatt
gctgcgctggttgccaaaggcgaaaccttggtggatcgcatttaccacattgatcgtggc
tacgaatgtatcgaagaaaaacttcagtctctaggtgcaaaaatccacagaatcccctca
aaacgaggcagctga

DBGET integrated database retrieval system