KEGG   Gamma proteobacterium HdN1: HDN1F_06430Help
Entry
HDN1F_06430       CDS       T01300                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gpb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:gpb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788583..789887
Genome map
AA seq 434 aa AA seqDB search
MLNIARLDTRQADFNAKLSALLDWESVSDDRVQAAVSEIVKDVRKRGDAALLEYTRRYDR
VSADRVEDLTLMPSDLRPYVEQLPRQEREALEAAAARVREYHEHQKAQSWRYTDSDGNVL
GQQITPLDRVGIYVPGGKASYPSSVLMNAIPAKVAGVREIIMVVPTPDGEKNAMVLAAAA
IAGVDRVVTVGGAQAVAALAYGTDSVPQVDKIVGPGNIYVATAKRMVFGQVGIDMIAGPS
EILVVCDGKTQADWIAMDLFSQAEHDEQAQAILISSDASFLDEVHAAMERLLPSLERESI
ARISLEGRGALIQAHSQEEVIELINRIAPEHLELSIADPEALLPSIRHAGAIFMGRYTPE
AIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIACSAQGGQKLGRIASVLARGEQL
TAHARSAEMRLKDV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacattgctcgcttggatactcgccaagcagactttaatgccaaactctccgca
ttgctcgactgggaaagcgtttccgacgatcgcgtgcaggccgctgtcagcgagattgtg
aaggatgttcgtaagcgtggcgacgccgcgcttttggaatacacccgccgctatgatcgt
gtcagcgctgatcgtgtggaagatttgacgctaatgccgtcagatttgcgcccttacgtc
gaacaacttcctcgccaagagcgtgaagcgctggaagctgcggccgcacgagtgcgggaa
taccacgaacatcagaaagcgcagtcctggcgttatacggattcggatggcaacgtgctc
ggccagcaaattacgccactggatcgcgtcggtatctacgtgcccggcggaaaagcctct
tacccatcctccgtgctcatgaacgccattcccgcaaaagtggccggcgtgcgcgaaatc
atcatggtggtaccaacccccgatggcgagaaaaatgccatggtgctggcggcggcggca
attgccggcgtggatcgagtcgtgaccgtcggcggtgcacaggcggttgcggcattggcc
tacggcactgacagcgtaccgcaggtcgataaaattgttgggccggggaatatctacgtc
gcgaccgccaagcgcatggtgttcggccaggtaggcatcgacatgattgccggccccagc
gagatcctagtcgtttgcgatggcaaaacccaagcagattggattgccatggatttattt
tctcaggcagagcacgatgagcaggcgcaggccattttgatcagtagcgatgcgagtttt
ctagatgaagtccatgcagccatggagcgcctgttgccttcgttggagcgcgagtcaatt
gcccgtatttcactggaagggcgcggggcgctgattcaggcgcacagccaagaagaagtc
atcgagttgatcaatcgcatcgcgcccgaacatttagaattgtccattgctgatccagaa
gcattgcttccctcgattcgccatgcgggtgccattttcatggggcgttatacgccagaa
gcgattggtgattattgtgcgggccccaaccacgtactccctacttccggcactgcgcgt
ttctcgtctccgcttggcgtgtatgattttcagaaacgcagctcgttgattgcgtgttcc
gcgcagggcggtcaaaaacttgggagaatcgcgtccgttctggcgcgcggcgaacaactg
acggcacatgctcgctctgcagaaatgcgtctgaaagacgtatag

DBGET integrated database retrieval system