KEGG   Gamma proteobacterium HdN1: HDN1F_06680Help
Entry
HDN1F_06680       CDS       T01300                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HDN1F_06680 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HDN1F_06680 (murE)
Enzymes [BR:gpb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     HDN1F_06680 (murE)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     HDN1F_06680 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812776..815700
Genome map
AA seq 974 aa AA seqDB search
MSARSREKRLGDLLAVEAEFADVMVSGLQQDSRKVQHGDLFVALKGHHVDGRDYIKDALK
RGASAVLADRVGVSAEQVVNAHGNVIWRDDLRSELGDIASRFYDEPSKQMRVIAVTGTNG
KTTVSHLLVRLLMRLGESAKTIGTLGYGHPDHLIPLANTTPDAIQLHEILAACREDGARF
VAMEASSHGLDQGRLGCVEISTAVFTNITRDHLDYHQTMQAYWEAKAKLASWHGLRNLVL
NADDAGVAKMAAVAEHGVKIVWFSLRADANVDVALVRCLYHPRGMSLDIRVKDEVYSFDT
RLMGEFNVANILAVLAALVSEGFSASLVVDALKEIAPVKGRMDCLPHTSGAQLPAVVIDY
AHTPDALQQALNALRHHCTTGKLWCVFGCGGDRDKGKRPLMGKIAASSADRVVVTSDNPR
SEVPDVIIAEIRGGMEATDQVRLVTDRGEAIRDAIFLAAPEDVILIAGKGHEDYQEVRGV
RSHFSDHEVAAAALLQRAQLSDSLPKGCGSVSERNQQECTLASLAERLGGELRGEDLPFA
GVSTDTRALKSMDVFFALVGEKFDAHDFLQQAKVAGACGAVVSRWVDVDLPQIKVEDTRL
ALGAWAGMFRDRFHPRVVAVTGSSGKTSVKEMLAAIFSEEGRVLATSGNLNNDIGVPLTL
LRLDDSYQFAVIELGANHVGEIAYTVGLVRPDAALITNVGEAHLEGFGSRNNIAKAKSEI
YTGLVPKGVAVVNLDDDYSQDFLTLNASRNVLTFSIENTRANCFAKSWSLDPVGRPRIEV
SINGELIQLSLNLIGKHQIANALAAAAAARAAGASLTSIRDGLNKLQPFKGRMFPKSLGR
WHWIDDTYNANPSSMRAAIDALARLDEPKVLILGRMGELGEQSAKLHADIGAYAARAGIR
RLFISRDDAGDYARGYRSVTNDGQLFVGDGPEAIAKQLIESMPEGVVLVKGSRSAAMEKV
FDEAQKRLLHEENH
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgatcaagagaaaagcgcttgggtgatttgcttgctgtggaggctgaattc
gcagatgtgatggtttccggcttgcagcaagatagccggaaggtgcagcacggcgattta
tttgttgcgctaaaggggcatcacgtagatggccgtgattatattaaggatgcactgaag
cgtggcgcaagtgctgtacttgcggatcgcgtaggtgtttctgcggagcaggtggtaaat
gctcatggaaacgtaatttggcgcgatgatttaaggagtgagctgggcgatatcgcaagc
cgtttctacgatgagccttccaagcagatgcgtgtcattgcggttaccggtacgaatggg
aaaaccacggtttctcatctgttggttcgcttgcttatgcgcctcggtgaatctgcaaag
accatcggcacgctcggatacggccatccggatcacttgattccattggctaatactacg
ccggatgcaatccagttgcatgagatccttgcagcgtgccgtgaggatggtgctcgcttt
gttgcaatggaggcatcgtctcacggtttggatcaggggcgtttgggttgtgtggaaatc
tcgacggcggtttttaccaatattacccgcgatcatctggattaccatcaaaccatgcaa
gcgtattgggaagccaaagccaagctggcgtcgtggcatgggttacgaaatcttgtgctg
aacgcagatgatgcgggtgttgcgaagatggcggcagttgcagagcatggcgtgaaaatt
gtttggttttcgctgcgggctgatgcaaatgtggatgtagctttggttcgttgcttgtat
cacccgcgagggatgtctctcgatattcgggtgaaggacgaagtgtattctttcgatacg
cgcttaatgggtgaatttaacgttgccaatattctggcggtcttggctgcgctggtttcg
gaaggcttttccgcatcgttggtagtggatgcgcttaaggaaattgcgccggtaaagggg
cgtatggattgtttaccgcatacgagcggagcgcaacttccggccgtggtgattgattat
gcgcatacgcctgacgcattgcagcaagctctgaatgcgcttcgccatcattgcacaact
ggaaagctttggtgcgtgttcggttgcggtggggatcgcgataaaggtaaacggccgctg
atgggaaagattgcagcatcgtcagcggatcgggttgtggtaactagcgataacccgcgt
agcgaggttccggatgtgatcatcgcggaaattcgcggtggcatggaggcgacagatcag
gtgcgcctcgttaccgatcggggcgaggctattcgtgacgcaatttttttggccgcgcct
gaagatgtgattctgattgcgggcaaagggcacgaagattatcaagaagtgcgcggagtt
cggtcccatttttctgatcatgaggttgcggcggcagcgcttttgcagcgtgcccaatta
tctgattcgctacctaaggggtgcggcagtgtgagtgagcgtaatcagcaggaatgtacg
ttggcttctttggcggagcgcttgggtggggagcttcgcggcgaagatttgccgtttgct
ggggtgtctaccgatacgcgcgcgctgaaaagcatggatgtgttttttgctttggtgggt
gagaaattcgatgcgcacgattttttgcagcaggcaaaagttgcgggtgcctgcggcgct
gttgtgagtcgttgggtggatgtagatcttccgcagattaaggtagaagatactcgtctt
gccttaggtgcttgggcaggaatgtttcgcgatcggtttcatccgcgtgttgttgccgtt
acgggcagcagcgggaagacatcggtaaaagagatgctggcagcgatttttagcgaagaa
ggtcgcgttttggcaacgagcggcaatttgaataacgacattggtgtgccgttgactttg
cttcgcttagatgactcctatcagtttgcggtgattgaactgggtgcaaatcacgttggc
gagattgcgtacaccgttggccttgttcgccccgatgcagcgttaattaccaacgtcggc
gaggcgcaccttgaagggtttgggagtcggaataatattgcgaaagcaaagtcggagatt
tacacaggtctagttcctaaaggcgttgcagttgtcaatttggatgacgattattctcag
gattttttgacgctgaatgcgtcaaggaacgtgctcaccttttcaattgagaacactcgt
gcgaactgctttgcgaaaagctggtcgctagatccggtggggcggccgcgcattgaagta
agcatcaatggtgaactcattcaattgtctctgaacttgatcggcaaacatcaaattgcc
aatgcactggccgccgctgcggcagcgcgtgccgcaggcgcgtcgctcacgtcgattcgt
gacggactaaataagctccaaccatttaagggacggatgtttccgaaatcgctagggcgt
tggcactggattgatgacacttataacgcgaatcctagttccatgcgtgctgctattgat
gcgcttgcacgcttggatgagccaaaagtgctgattctggggagaatgggggagttaggc
gaacagagtgcaaagttgcatgccgatatcggtgcatatgcagcgcgcgcaggaattcgc
cggctgtttatttccagagacgacgccggtgattacgcgcgtggttaccgttccgtaacc
aacgatggtcaattgtttgtaggcgatggccccgaagccattgcaaaacagcttattgaa
tccatgccggaaggcgtggtgctcgtgaagggatcgcgtagcgcagcgatggaaaaagta
tttgatgaagcccaaaaacggcttctgcacgaggaaaatcactga

DBGET integrated database retrieval system