KEGG   Gamma proteobacterium HdN1: HDN1F_07700Help
Entry
HDN1F_07700       CDS       T01300                                 

Gene name
aceF
Definition
pyruvate dehydrogenase, E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDN1F_07700 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDN1F_07700 (aceF)
   00020 Citrate cycle (TCA cycle)
    HDN1F_07700 (aceF)
   00620 Pyruvate metabolism
    HDN1F_07700 (aceF)
Enzymes [BR:gpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HDN1F_07700 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
946658..948319
Genome map
AA seq 553 aa AA seqDB search
MSNQEIHLPDIGTKDAVDIIEVTVKVGDSVEKDGTLIVLESDKATMEIPSPEAGVVKELK
VKVGDSIKTGDVVLVMETSAATSSAPPEKPAAKVDSEKPAATPATKATAPASTPASASKT
QTISKEIKLPDIGTKDAVDIIEVSVKQGDRVEKDGTLIVLESDKATMEIPSPEAGVVETL
KVKVGDSVSTGSVILTLIVTESVGADVAQEVPSVAPASAQVVPSQESPTPVTLHAEPAQR
STQEAAIVKPSREVHAGPAVRRLARELGADLGLVLGTGPRNRILKEDVHAWVKQRLSASV
VAASEVRGSGLPELPEIDFSAFGDTETQELSRINRLSATYLHRAWVHIPHVTQFDEADIT
DLEAFRKVEAAALKASGTRLTILAFLVKAVVKSLKQFPRFNSSLSKDGNTLILKKYYHIG
IAVDTPNGLVVPVIRNADQKSLLEIAQEMQEISAKARDKKLQPADMQGGCFSISSLGGIG
GTAFTPIVNWPEVSILGVSKMAEKPQWNGKKFKPRLMLPLSLSYDHRVIDGAEAARFITH
LSQTLGDIRRLLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatcaagaaatacatttgccagatatcggcactaaagatgccgtagatatcatt
gaagtaacggtgaaagtaggggattccgttgagaaagacggtaccctgatcgttttggaa
tccgacaaagcgaccatggaaatcccctcacctgaagccggcgtcgtaaaagagttgaag
gtgaaagtgggtgattccatcaagaccggcgatgtcgtccttgtgatggaaaccagtgcc
gcgacatcctcggcgccgcccgaaaaaccggcagcgaaggtggactctgagaagcctgca
gcaacgcctgctacgaaagcgactgcgcccgcatctacgcccgcatccgcatccaaaacg
caaaccatcagcaaggaaatcaagctcccagatattggcacaaaggacgcagtcgatatt
atcgaagtgtctgtaaagcagggagatcgagtcgagaaagatggcacacttatcgtgctg
gaatctgataaggccaccatggaaattccgtcacctgaagcaggggttgtagaaacgctt
aaggtgaaggtgggggattcggtcagcacaggaagtgtgattctcacattgatcgttacc
gaatcggtgggcgccgatgtagcgcaagaagtgccttcggtggctcctgcaagtgcgcaa
gtggttccttcacaagaaagcccaacgcctgtgactctgcacgccgagcctgcccagaga
tcaacgcaagaggctgcgatcgtgaaaccctcgcgtgaggttcacgcgggccctgcggtg
cgccgtttagcgcgtgaactcggcgccgacctaggtttggtgcttggcacgggcccacgc
aaccgtattctcaaggaagatgtacacgcatgggtgaaacaacgcttaagcgcctcggtt
gttgcagcgagcgaggttcgtggttcgggcctcccagaattgccggaaatcgactttagc
gcgtttggcgataccgaaacgcaggaactctcccgcattaaccggctgagcgccacttac
cttcatcgtgcgtgggtacatattccccacgttacgcagtttgatgaggcggatattacg
gacttggaagccttccgcaaggttgaggcggcagcactcaaggcaagcggaacccggctt
actatattggcctttttggtaaaggcagttgtgaaatcgcttaaacagttcccgcgcttt
aatagctcgctttcgaaagatggcaacacgctgattctgaaaaagtattaccacatcggc
attgcggtagatacgcccaatggcctcgtagtgccggtaattcgaaatgccgaccagaaa
agccttttggaaatcgcccaagaaatgcaggaaatcagcgcaaaagctcgtgataaaaag
ctgcagcctgcagacatgcagggggggtgtttttcaatttcttcgctcggcggaattggc
ggaacagcttttacgcccatcgtaaactggccggaagtatccattttgggcgtatcaaaa
atggcagagaaaccgcagtggaatggcaagaaattcaagccacgcctaatgttgccactc
tcgctgtcgtatgaccatcgcgtgattgatggcgcggaagccgcgcgctttatcacgcac
ttgtcccaaacgcttggagatattcggcgcttgctgctctag

DBGET integrated database retrieval system