KEGG   Gamma proteobacterium HdN1: HDN1F_07920Help
Entry
HDN1F_07920       CDS       T01300                                 

Gene name
cpx
Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HDN1F_07920 (cpx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
976392..977462
Genome map
AA seq 356 aa AA seqDB search
MKRMKMINHHHRHTGVSLLVSLLLASPFAVAVEYKDHTFSAGDASLQHWLLPAVPVPADN
ALNADRIALGKQLFFDPRLSGDSNMSCATCHNPLFGWSDGLPTAKGSKSMVLGRASPTVI
NTAYNTLQMWDGRKKSLEDQAMGPMMSNQEMNMNIPKLLDFLQKTPDYSASFNKAYPGEA
ISEVTIAKAIASFERTVLSNDSQFDRWIKGDKNAMTAQQVNGFKLFVNPDKGNCAVCHSA
PNFTDNGFHNIGLASFGGATPDVGRFAEKPLKLMKGAFKTPTLRDITLTAPYFHDGSAST
LEQVVDHYVQGGEVKTNLAPNLKSLTLSSNEKADLVAFMRALTSDHPAFVLPVLPH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgtatgaaaatgatcaatcatcaccatcgccacacaggtgtcagcctgctggta
tcgctgctactggccagcccctttgcagttgccgtggaatacaaggatcacacgttctct
gctggtgatgcatcgctgcaacactggctgctgccggcggtgcctgtgccggcagacaac
gcactgaatgcggatcgcatcgcgctgggcaaacagttgtttttcgatccacgtctgagc
ggcgacagtaatatgtcctgcgccacctgccacaacccgttatttggctggtcggacggt
ttgcccaccgccaagggttcaaaaagcatggtgctgggccgcgcctcgcccacagtcatc
aatacggcatacaacacgctgcaaatgtgggatgggcgcaaaaaatcactggaagatcag
gccatggggccgatgatgtccaatcaggaaatgaacatgaacattcccaagctgctcgat
ttcctgcagaaaaccccagattacagtgccagtttcaacaaggcatatccaggtgaagcc
atcagcgaagtcaccatcgccaaggccattgccagttttgagcgcaccgtgttgagcaac
gattcccagtttgatcgctggatcaagggcgacaaaaatgcgatgacagcgcaacaggtc
aacggctttaagctgttcgtcaatccggacaaaggcaattgcgccgtatgccattcagcg
ccgaatttcaccgacaacggtttccacaatatcggtctggcttcctttggcggcgctaca
ccggatgtgggccgcttcgcggaaaaaccgctcaagctgatgaaaggcgcgttcaagaca
cccaccctgcgtgacatcacactgacagcgccctattttcatgatggctctgccagcaca
ctggaacaggtcgtcgatcattacgtccagggcggtgaggtaaaaaccaatctagcgcct
aacctaaaaagcctgaccttgagcagcaacgaaaaagccgatctggtggccttcatgcgc
gcattgaccagcgatcatccggcgtttgttctgccggttctaccacactga

DBGET integrated database retrieval system