KEGG   Gamma proteobacterium HdN1: HDN1F_08590Help
Entry
HDN1F_08590       CDS       T01300                                 

Gene name
dhpS
Definition
dihydropteroate synthase FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HDN1F_08590 (dhpS)
Enzymes [BR:gpb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HDN1F_08590 (dhpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055020..1055880
Genome map
AA seq 286 aa AA seqDB search
MNHDSKSLRCGKRVLGLSRPQVMGILNVTPDSFSDGGHHFRWQDALDHADAMVQQGAAII
DIGGESTRPGAATVSSQQELDRVLPVLEAITARFDTVCSVDTSNPVLMCEAVRLGAGMLN
DIRAFQRPDAEAAALDAAQRHGVALCIMHMQGEPANMQTAPHYQNVVQEVRAFLISRASR
FEQLGVPATQLVLDPGFGFGKDLAHNYALLRELVQLTQQRFAVLAGLSRKSMIGAVVNRP
IDQRLSGSLAAAVLAAERGVSILRVHDVAATVDALKVLDYVLRPAQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgattcaaaaagccttcgctgtggcaagcgggtgttagggctttctcgcccg
caagtgatgggcattctcaacgtaacccctgattctttttccgatggtggccaccatttc
cgttggcaagacgctcttgaccacgctgatgcgatggttcaacaaggcgcagcgattatt
gatatcggcggtgaatcaacccgccctggagcagcaacggttagcagtcaacaagaactg
gatcgcgtccttcccgtgctggaagcgattacggcccgctttgataccgtttgttccgta
gacaccagcaatccggtattgatgtgcgaggcggttaggctgggtgcgggtatgctcaat
gacattcgagcctttcagcggcccgatgccgaagctgcggccctagatgccgcgcaacgg
catggtgtcgcgctttgcatcatgcatatgcagggcgaacctgccaatatgcaaaccgcg
cctcattatcaaaacgtcgtgcaagaagtacgcgcttttctgatttcaagggcaagccgc
tttgaacaacttggcgtgccggcaacgcagctagtgttagatccgggttttggctttggc
aaagatctggcacataattacgctttgctacgtgagcttgtacagcttacgcagcagcgt
tttgcggtgcttgctgggctctctcggaagtccatgatcggagccgtagtaaaccgccct
attgatcaacgcctgtcgggtagccttgcggctgctgtgctggcggcggagcggggagta
agcattttaagagttcatgacgtggctgcgacagtggacgcgctaaaagtgctggattac
gttttgcgaccagcccagtga

DBGET integrated database retrieval system