KEGG   Gamma proteobacterium HdN1: HDN1F_08610Help
Entry
HDN1F_08610       CDS       T01300                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00010  Glycolysis / Gluconeogenesis
gpb00051  Fructose and mannose metabolism
gpb00562  Inositol phosphate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
gpb01230  Biosynthesis of amino acids
Module
gpb_M00002  Glycolysis, core module involving three-carbon compounds
gpb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDN1F_08610 (tpiA)
   00051 Fructose and mannose metabolism
    HDN1F_08610 (tpiA)
   00562 Inositol phosphate metabolism
    HDN1F_08610 (tpiA)
Enzymes [BR:gpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HDN1F_08610 (tpiA)
Exosome [BR:gpb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HDN1F_08610 (tpiA)
  Exosomal proteins of bladder cancer cells
   HDN1F_08610 (tpiA)
  Exosomal proteins of melanoma cells
   HDN1F_08610 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBL44444
UniProt: E1VI02
Position
1057411..1058229
Genome map
AA seq 272 aa AA seqDB search
MPSFRGGWALVRVSQQKHPEPRPLVVGNWKMNGTPVTVSALLSALQRHALSGELTARADV
AVCPASIFIPQALTVLAGTAVTIGAQNAAAHESGAYTGEVSAGMLAAFGVRYVILGHSER
RALFGDQDDVVAKKVRQALNAGLVPIVCVGETLAERESGATFDVVRRQLKAVIEEVGMDA
LSRCVLAYEPVWAIGTGVTATPAQAQEVHAFLRQMLAASSREVAGQIQILYGGSVKASNA
AELFACEDIDGGLIGGASLDSEEFLAICQAAK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgccttcttttcgaggaggatgggcattggtacgcgtttcccagcaaaaacacccagag
ccgcggccgttggtggtcggtaactggaaaatgaacggcacgcccgtaacggtgagtgct
ctgctcagcgcactgcaaaggcacgcactgagcggcgaactgactgcgcgagccgatgta
gcagtctgccctgccagcatcttcatcccccaagcgctcaccgtgcttgcaggaacagcc
gtcacaataggtgctcagaacgctgccgcccatgaatctggcgcctataccggcgaagtc
tcggcagggatgcttgcagctttcggtgtgaggtatgtgattcttggccactcggagcgg
cgtgctctttttggtgatcaagatgacgttgtcgcaaaaaaggtgcggcaggcgctgaat
gcggggttggtacccattgtttgtgtcggagaaaccctagcagagcgcgagagcggcgcg
acctttgatgttgtgcggcgccagctgaaggccgtaatcgaagaggtcggaatggatgct
ctttcgcgctgcgtgctggcttacgagccggtttgggcgatcggtacgggagtgactgct
acacctgcacaagcacaagaagttcacgcgtttttgcgccaaatgctcgcggcgtcatcg
cgtgaggttgcagggcagattcaaattctttatggcggcagcgtaaaggcgagcaacgca
gcggagctttttgcgtgtgaagatatcgatggtggattgattggtggtgcgtccttggac
tcagaagagtttttggcgatttgccaagcggctaaataa

DBGET integrated database retrieval system