KEGG   Gamma proteobacterium HdN1: HDN1F_09650Help
Entry
HDN1F_09650       CDS       T01300                                 

Gene name
trpB1
Definition
(GenBank) Tryptophan synthase b subunit, gene: trpB
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDN1F_09650 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDN1F_09650 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDN1F_09650 (trpB1)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HDN1F_09650 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1188304..1189512)
Genome map
AA seq 402 aa AA seqDB search
MTEHTLNGVALPDEQGFFGEYGGQFIPPHLKQAMDDINQAYEEIRQQPTFQQELQELFTH
YVGRPSPIFHAKRLSEQLGGAQIFLKREDLNHTGAHKINHCLGEALLAKYMKKSKVIAET
GAGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGATLVPVTRGTATLKDAV
DNAFEEYLKDPTNFIYAIGSVVGPHPFPKMVRDFQSIVGKEIKQQFQERFHQLPDYVVAC
VGGGSNAIGAFTAFLADDSVKLVGVEPAGMGLETDKHAATMTKGKPGQIHGMACYVLEDD
KGEPLPVHSIASGLDYPGVGPEHSYLKDLGRVRYESATDQECLDAFMRLSRIEGIIPALE
SSHAVAWAIREAPRMSKDARIVVNLSGRGDKDADYVANKLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatacgcttaacggtgtcgcacttccggacgaacaaggcttttttggtgaa
tacggcgggcaatttattccgccacacctcaagcaggcgatggatgacatcaaccaagcc
tatgaagaaatccgccagcagccaacgttccaacaggaactacaagagcttttcacccac
tacgtcggccgaccaagccccatttttcacgccaagcgcctgtccgagcagctcggtggc
gcgcagatttttctgaagcgcgaagatttgaaccacaccggtgcccacaagatcaaccac
tgtctgggtgaggcactgcttgcgaagtacatgaagaaaagcaaggtgatcgctgaaacc
ggcgcagggcaacatggcgttgcactggcaaccgcctgtgccttggttggtattccttgc
gagattcatatggggcaggtggatattgaaaaagagcatcccaacgttgtcaaaatgaag
attcttggcgctacccttgtgccagttacacgcggtacggcgacactgaaagatgctgtg
gacaatgccttcgaagaatacctgaaggatcccacgaacttcatttatgccattggttcg
gtggtgggccctcacccctttccaaagatggtgcgcgactttcagtccattgttggaaaa
gagatcaagcagcagtttcaggagcgcttccaccaattgccggattatgtggtggcgtgt
gtaggcggtgggtcaaacgcgattggcgctttcacggcgttcttggcggatgattccgtc
aaactggtcggcgtagaaccggcaggtatgggcttggaaactgataagcacgcggccacc
atgacaaaaggcaagccaggccaaatccacggcatggcttgctatgtcctagaagatgac
aaaggtgagccactgccggtacattcgattgcatcgggcttggattatccgggcgttggc
cccgaacacagctatctgaaagatttgggcagggtgcgttatgaatcggcaaccgatcaa
gaatgcttggatgcgtttatgcgcctttcccgcatagaagggatcattcccgcgctagaa
agttcacacgcggtcgcttgggcaatccgagaggcgccgcgcatgtcaaaagacgcgcga
atcgtggtaaatctatctggtcgcggcgacaaagacgcagattatgtggcgaataaattg
gggctctag

DBGET integrated database retrieval system