KEGG   Gamma proteobacterium HdN1: HDN1F_11040Help
Entry
HDN1F_11040       CDS       T01300                                 

Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     HDN1F_11040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377206..1378222)
Genome map
AA seq 338 aa AA seqDB search
MSEGTKPEGSKPRIAYVTGSTGFLGLNIVECLVEQGWQVYALRRKSSNTRDLDRMAVTQV
EGDVTDIESLRRTMPDGLDAVFHVAADTSMWSKKNERQNEININGTRNVVEVALEKKVGR
FIHTSSVGAFGTIPDREISENTPSQALRSPINYYRSKYFAEKEVFAGITRGLDAVILNPA
QIVGPYDYNYTPLMFRTIKSGGMLAVPKGGSVLGHVRDYARAHVTAYEKGRTGERYLLGG
VHASFREVFATIGKILNCKTPSRTFPAWLMTLIAIVMDRISQYTNKEPILCTEKVILMNT
DMRISSKKAEQELGFSTCSLEEMFRDAWQWMQQSGVRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaggaacaaaaccagaaggatccaagccacgcattgcgtacgttacgggaagc
accggatttctcggcctgaatatcgtagaatgcttggtcgagcagggctggcaagtgtac
gccctacgccgtaaaagctcgaatacgcgcgaccttgaccgtatggcggtaacgcaggta
gagggcgatgtcaccgacattgaatcgctgcgccgcaccatgccagacggtttggacgcg
gtgtttcacgtggcggctgacaccagcatgtggtcaaagaaaaatgagcgccaaaacgaa
atcaacatcaacggcacccgcaacgtggttgaggttgctcttgagaaaaaagtcgggcgc
tttatccacacatcgtcagtaggcgcgtttggcaccatccctgatcgcgagattagcgaa
aatacaccatcacaagccttgcgcagcccaatcaattactaccgatccaaatacttcgca
gaaaaggaggtgttcgcaggaatcactcgcggattagacgcggtcatcctgaaccccgcg
cagatcgtaggcccctacgattataattatacgccgctgatgttccgcaccatcaaaagc
ggcggaatgctggccgtacccaaaggtggaagcgtgctcggccacgtaagggattacgcg
cgcgctcacgtcaccgcgtacgagaaaggtcgaaccggggagcgttatttacttggcggc
gtacatgcctcgttccgcgaggtttttgcaaccatcggcaaaatcctgaattgcaaaacg
ccctcccgtacctttcctgcgtggctgatgacgctgattgcgatcgttatggatcggatc
tctcaatacacgaataaggagccgattctgtgcacagagaaggtgattcttatgaatacc
gatatgcgcatcagctctaagaaagcggagcaagaacttgggtttagcacctgctcccta
gaggaaatgttccgcgatgcttggcaatggatgcagcaatcgggggtacgaagctag

DBGET integrated database retrieval system