KEGG   Gamma proteobacterium HdN1: HDN1F_12900Help
Entry
HDN1F_12900       CDS       T01300                                 

Gene name
hexC
Definition
N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HDN1F_12900 (hexC)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HDN1F_12900 (hexC)
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HDN1F_12900 (hexC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1599400..1600410
Genome map
AA seq 336 aa AA seqDB search
MSGPLMLDLPGLDLTAADADLLCAPEIGGVILFARNYEDPHQLAELVARVRAVRGDVLLA
VDQEGGRVQRFKKGFTRLPAVRVLGDLYDQNPENALYLAREWGWLMAAELRAFDIDLSFA
PVLDLDYSRSQVIGNRAFHSKPSAVLALAEAWIAGMAEAGMAATGKHFPGHGWVTADSHT
DIPVDERTEAELQNADLQPFVRLAEQLGGMMPAHVIYSAVDAKPAGFSRYWLQTVLRERL
RFQGAIFSDDLAMEGAAVAGSFSERAQQALDAGCDMVLVCNQRSAALEVLESLQRQPRPA
NARIQALRGQKAPTLAELKNSDRWQEARASMAPFSP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccctttgatgcttgatctgcccggtttggacttaacagccgctgatgcagac
ctattgtgcgctcccgaaattggtggcgtaattttattcgcgcgcaattatgaagacccg
caccagctcgcggagctagtggcaagggtgcgagcggttcggggagacgtactgctggcg
gtcgatcaagagggcggccgcgtgcagcgtttcaaaaaggggttcacccgtctgcccgca
gtgcgcgtgttaggcgatttgtacgatcaaaacccggaaaacgccctgtacctcgcgcgt
gaatggggttggctgatggccgctgaattgcgtgctttcgacattgatttgtcttttgcg
ccggtactggatctggattattcgcgtagccaagtgatcggtaaccgcgcgtttcactca
aagccaagcgcggtgcttgccttggcagaggcgtggattgcggggatggcagaggcgggt
atggcggccaccggcaagcattttcctggccatggttgggtaactgcggattcgcacacc
gatattcccgtagatgagcgcaccgaggcggagttgcaaaacgcggatttgcaacccttt
gtgcggcttgcggagcaacttggtggcatgatgcctgcacacgtcatttattccgctgtc
gatgcgaagcccgctggtttctcgcgttactggctgcaaactgtgttgcgtgagcggctc
agatttcaaggggcgattttcagcgacgatctggcgatggaaggcgctgcggtggcgggc
agcttttcagagcgcgcccaacaggcgctggatgcaggctgtgatatggtgttggtatgc
aaccagcgtagtgccgcgctcgaagtgttggagagtctacagcgccagccgcggcctgca
aatgcgcgcatccaagcactgcggggccagaaggcacctacgctggctgaattgaaaaac
tccgaccgctggcaagaggcgcgcgcaagtatggcacctttttcaccatga

DBGET integrated database retrieval system