KEGG   Gamma proteobacterium HdN1: HDN1F_13530Help
Entry
HDN1F_13530       CDS       T01300                                 

Definition
aspartate aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    HDN1F_13530
   01230 Biosynthesis of amino acids
    HDN1F_13530
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDN1F_13530
   00290 Valine, leucine and isoleucine biosynthesis
    HDN1F_13530
Enzymes [BR:gpb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HDN1F_13530
    2.6.1.66  valine---pyruvate transaminase
     HDN1F_13530
Amino acid related enzymes [BR:gpb01007]
 Aminotransferase (transaminase)
  Class I
   HDN1F_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1684345..1685628)
Genome map
AA seq 427 aa AA seqDB search
MPRSKRLLTVNRKKWYLIMKPVKKSTKLHNVCYDIRGPVLAHARKLEEDGQRVIKLNIGN
PAPFDFVPPDEIVQDVIANLPNASGYCDSKGLFSARKAVMQDCQKKGIANVGIDEIYLGN
GASELIVMSMQALINNGDEVLIPMPDYPLWTAAVSLAGGKAVHYLCDEQAEWYPDLEDIR
NKVNERTKAIVIINPNNPTGTVYPPEILEGMIEIARQHNLVVFSDEIYDKILYDDAHHVS
TASLADDLLFVTLNGLSKTYRAAGYRSGWMILSGNIRDARDYIEGLEMLSSMRLCANVPS
QYAIQTALGGYQSIYELTKPGGRLHRQRDTAWRLLNEIPGVSCVKPRAALYMFPKLDPKV
YPITNDQDFILDLLVQEKVLVVQGSGFNWPAPDHFRVVFLPREEDLVDAIGRIARFLERY
RNQHRQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgttctaagcgattgctaaccgttaaccgaaagaagtggtacctcatcatgaag
cccgtaaaaaaatcaaccaagctccacaacgtttgttacgacattcgcgggcctgtgttg
gcacacgcgcgcaaattggaggaggacgggcaaagagtcatcaagctaaacatcggcaac
cccgcaccttttgactttgtaccacccgatgaaatcgtacaggatgtgattgccaacctg
ccgaatgcatctggctattgtgattccaaagggctctttagcgcacgcaaagcagtcatg
caggattgccaaaagaaaggcattgctaacgtagggatcgacgagatctatctggggaac
ggcgcgagcgagctgatcgtaatgtcgatgcaggcactcattaacaatggggatgaagtc
ctcattccaatgcctgactatccactctggacggccgcagtgagcctcgctggcggaaaa
gccgttcactatctatgcgacgaacaggccgagtggtatcccgatttagaggacatccgc
aacaaggtcaacgaacgtaccaaggcaattgtgattatcaaccccaataatcccactgga
accgtctatcctccagagattcttgagggcatgatcgagatcgctcgccagcacaatctt
gtcgtgttttcagatgaaatttacgacaagattctctacgacgatgcgcaccacgtttcc
accgcatcgctcgcagacgatctattgttcgtaacgctcaacggcctctccaaaacctac
cgagccgcaggctaccgctctggatggatgattctttccggcaatatccgcgatgcacgc
gactatatagaaggcttggagatgctttcctccatgcgtctctgtgcgaacgtaccgtct
caatacgccattcaaaccgcactcggcggataccagagtatttacgaactcaccaaaccc
ggcgggcgcctgcaccgccagcgcgataccgcgtggcggctgctcaatgaaattcctggg
gtaagctgcgtgaagccacgcgcagcgctgtatatgttccccaaactggatccaaaggtt
tatccgatcactaacgatcaggatttcattctggatctgctggtgcaggaaaaagttctg
gtcgtccaaggcagcggctttaactggccagcccccgatcacttccgcgtagtgtttcta
ccgcgcgaagaagatctggtagacgcaatcggacgaatcgcacgcttcctagaacgctat
cgcaaccagcatcgccaaggctaa

DBGET integrated database retrieval system