KEGG   Gamma proteobacterium HdN1: HDN1F_13530Help
Entry
HDN1F_13530       CDS       T01300                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00220  Arginine biosynthesis
gpb00250  Alanine, aspartate and glutamate metabolism
gpb00290  Valine, leucine and isoleucine biosynthesis
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01130  Biosynthesis of antibiotics
gpb01210  2-Oxocarboxylic acid metabolism
gpb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDN1F_13530
   00290 Valine, leucine and isoleucine biosynthesis
    HDN1F_13530
   00220 Arginine biosynthesis
    HDN1F_13530
Enzymes [BR:gpb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HDN1F_13530
    2.6.1.66  valine---pyruvate transaminase
     HDN1F_13530
Amino acid related enzymes [BR:gpb01007]
 Aminotransferase (transaminase)
  Class I
   HDN1F_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBL44936
UniProt: E1VJE4
Position
complement(1684345..1685628)
Genome map
AA seq 427 aa AA seqDB search
MPRSKRLLTVNRKKWYLIMKPVKKSTKLHNVCYDIRGPVLAHARKLEEDGQRVIKLNIGN
PAPFDFVPPDEIVQDVIANLPNASGYCDSKGLFSARKAVMQDCQKKGIANVGIDEIYLGN
GASELIVMSMQALINNGDEVLIPMPDYPLWTAAVSLAGGKAVHYLCDEQAEWYPDLEDIR
NKVNERTKAIVIINPNNPTGTVYPPEILEGMIEIARQHNLVVFSDEIYDKILYDDAHHVS
TASLADDLLFVTLNGLSKTYRAAGYRSGWMILSGNIRDARDYIEGLEMLSSMRLCANVPS
QYAIQTALGGYQSIYELTKPGGRLHRQRDTAWRLLNEIPGVSCVKPRAALYMFPKLDPKV
YPITNDQDFILDLLVQEKVLVVQGSGFNWPAPDHFRVVFLPREEDLVDAIGRIARFLERY
RNQHRQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgttctaagcgattgctaaccgttaaccgaaagaagtggtacctcatcatgaag
cccgtaaaaaaatcaaccaagctccacaacgtttgttacgacattcgcgggcctgtgttg
gcacacgcgcgcaaattggaggaggacgggcaaagagtcatcaagctaaacatcggcaac
cccgcaccttttgactttgtaccacccgatgaaatcgtacaggatgtgattgccaacctg
ccgaatgcatctggctattgtgattccaaagggctctttagcgcacgcaaagcagtcatg
caggattgccaaaagaaaggcattgctaacgtagggatcgacgagatctatctggggaac
ggcgcgagcgagctgatcgtaatgtcgatgcaggcactcattaacaatggggatgaagtc
ctcattccaatgcctgactatccactctggacggccgcagtgagcctcgctggcggaaaa
gccgttcactatctatgcgacgaacaggccgagtggtatcccgatttagaggacatccgc
aacaaggtcaacgaacgtaccaaggcaattgtgattatcaaccccaataatcccactgga
accgtctatcctccagagattcttgagggcatgatcgagatcgctcgccagcacaatctt
gtcgtgttttcagatgaaatttacgacaagattctctacgacgatgcgcaccacgtttcc
accgcatcgctcgcagacgatctattgttcgtaacgctcaacggcctctccaaaacctac
cgagccgcaggctaccgctctggatggatgattctttccggcaatatccgcgatgcacgc
gactatatagaaggcttggagatgctttcctccatgcgtctctgtgcgaacgtaccgtct
caatacgccattcaaaccgcactcggcggataccagagtatttacgaactcaccaaaccc
ggcgggcgcctgcaccgccagcgcgataccgcgtggcggctgctcaatgaaattcctggg
gtaagctgcgtgaagccacgcgcagcgctgtatatgttccccaaactggatccaaaggtt
tatccgatcactaacgatcaggatttcattctggatctgctggtgcaggaaaaagttctg
gtcgtccaaggcagcggctttaactggccagcccccgatcacttccgcgtagtgtttcta
ccgcgcgaagaagatctggtagacgcaatcggacgaatcgcacgcttcctagaacgctat
cgcaaccagcatcgccaaggctaa

DBGET integrated database retrieval system