KEGG   Gamma proteobacterium HdN1: HDN1F_13550Help
Entry
HDN1F_13550       CDS       T01300                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HDN1F_13550 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HDN1F_13550 (btuE)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HDN1F_13550 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1686776..1687267
Genome map
AA seq 163 aa AA seqDB search
MKTVFDFSATDLKGAEQALEQYQGKVLLIVNTASKCGFTPQYEGLEALWEKYAAQGLVVL
GFPCNQFGHQEPGTSEQIASFCDLNYGVSFPMFGRIDVNGAAAHPLFAHLKKAAPGLLGT
EAIKWNFTKFLVNRKGEVVARFASKDRPASIENRIQSLLAESV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacagtgtttgatttttctgcgacggatctaaagggcgccgagcaagcgttagag
caatatcagggcaaagtcctgctcatcgtcaatacggcgagtaagtgcggttttacgccg
cagtacgaggggttggaagcgctctgggagaagtacgctgcgcaggggcttgtggtgctt
ggctttccctgcaatcagtttggacaccaagagccgggaacgagtgaacagattgcgagt
ttttgcgatctaaattacggtgtaagttttccgatgtttggtcgtattgatgtcaacggg
gcggctgctcatccgctgtttgctcatctaaaaaaggcggctccagggcttttgggaacc
gaagcgatcaaatggaattttacgaagttcctagtgaatcgtaagggggaggtggtggct
cgctttgcttcgaaggatcgcccagcgagcattgaaaatagaatacagtcattgctggca
gaatccgtttag

DBGET integrated database retrieval system