KEGG   Gamma proteobacterium HdN1: HDN1F_14190Help
Entry
HDN1F_14190       CDS       T01300                                 

Definition
glycosyl transferase family protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gpb00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1766014..1767564)
Genome map
AA seq 516 aa AA seqDB search
MTETNPPNTFSTLRLKRIAIDTYHENVAYLHRECEIYKAEGFQALSKIEVSSNSHRILAS
LNVVDDRNIVAPCELGLSEQSFDQLGLAEGTEVSVAHAEPPQSMEHVRAKLSGERLSQAQ
LKAIVSDIAENRYSKPEIAAFLVTVAEAGLDRDEILFLTRAMVESGHRLNWHDPIVVDKH
CIGGIPGNRTSMIVVPIVAAYGLLCPKTSSRAITSPAGTADTMEVFAEVDLPPERLHEIV
REEKGCLAWGGTARLAPVDDVLISVERPLNIDSQAQMVASILSKKVACGSTHLLIDIPTG
PTAKVRSAREAIQLRKLFEYVGERMGLQVQIVITDGRQPIGRGIGPLLEAQDVMQVLQNA
PDAPHDLREKSLQLAGRMIEFDTYVRGGEGYSIARDILDSGRALEKMNALIHAQGPQSRK
WTLGALTHELTAKRSGYVAGIDNLALSRAARLAGAPMDKGSGVYVMKRIGDPVQAGEPLF
RIHSQFPADMQFAIRWLNTHPVYRITDQPPASYSWL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccaacccgcccaacacgttctcaacactgcgccttaaacgaatcgccatc
gacacctaccacgaaaacgtcgcctacctccatcgcgaatgcgagatctacaaagcggaa
ggctttcaggcgctcagcaaaatcgaagtcagcagcaacagccaccgtattcttgcgtcg
ctcaacgtagtggatgatcgcaacatcgtcgccccgtgtgagctcggcctgtccgaacag
agcttcgatcaactcggcctagcagaaggcacagaagtcagcgtcgctcacgcagaaccg
ccgcaatccatggaacacgttcgcgccaagctctcgggggaacgcctctcgcaagcgcaa
ctcaaagcgatcgttagcgacattgcagaaaaccgctactccaaacccgaaattgccgcc
tttctcgttaccgtagccgaagccggcctagatcgcgacgagatcctgtttctaacgcgc
gccatggtggaatccggccatcgcctgaactggcacgaccccattgtggtagacaaacac
tgcatcggcggcatccccggcaaccgcacctccatgatcgtcgtgcctattgttgctgcc
tacgggctgctctgccccaaaacctccagccgcgcaatcacttcccccgccggcaccgcc
gacaccatggaagtattcgcagaagtcgatctcccccccgagcgcctccacgaaatcgtg
cgcgaggaaaaaggctgtcttgcttggggcggcactgcgcgcctcgcccccgttgacgac
gttctaatctctgtagagcgccctctcaacatcgactctcaagcgcagatggtggcctcc
atcctctccaaaaaagtcgcctgcggctccacccatctgctgatcgacatccccaccggc
cccaccgccaaggtgcgctccgcccgtgaagccatccagcttcgcaaactatttgaatac
gtgggcgaacgcatgggccttcaggtgcaaatcgtgatcaccgatggccgccagcccatt
ggccgaggcatcggccccttgctcgaagcacaagatgtgatgcaggtgctacagaacgcg
cccgatgcaccgcacgacctgcgcgaaaaaagcctgcaactcgcaggccgcatgattgaa
ttcgacacctacgtgcgcggcggcgaaggctacagcattgcccgcgacattctggattcg
gggcgcgcactcgaaaaaatgaacgccctcatccacgcacaaggcccccaatctcgcaaa
tggacactgggcgcactcacccacgagctcaccgccaaacgcagtggctacgtggcggga
atcgacaatctcgcgctttccagagccgcccgcctcgccggtgctcccatggacaaaggc
tcaggcgtttacgtaatgaaacgcatcggagatcctgtacaagcaggcgagccgttattt
agaatccactcccagtttccagcggatatgcaatttgccattcgctggctcaacacccac
ccagtctaccgcattacagaccaaccccctgccagttactcttggctttaa

DBGET integrated database retrieval system