KEGG   Gamma proteobacterium HdN1: HDN1F_15610Help
Entry
HDN1F_15610       CDS       T01300                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase, E2 subunit
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDN1F_15610 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_15610 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    HDN1F_15610 (sucB)
Enzymes [BR:gpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HDN1F_15610 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987127..1988401
Genome map
AA seq 424 aa AA seqDB search
MAIEIEIKAPQFPEAVADGTVATWHKKVGDTVSRDELLVDIETDKVVMEIVAPHDGVLTK
IIKQAGDTVLSQELIGKLSETGAGHTHTESAQDQPQAAAQTAASDEAVDDAWGPAVRKLI
ADNKIDANKVTGTGKGGRITKEDVLNYLSSSQTKTAAASSPAATSVSAVSPSAPQTAPAA
PAASVAAFAADDRVEKRVPMTRLRARIAERLVSAQHNAAMLTTFNEVNMKPIMDMRKNYK
DAFEKAHGVRLGFMSLFVRAAVEALKRFPSVNASIDGNDIVYHGYYDVGVAVSSERGLVV
PVMRDVDKMGFSEVEGKIAEYGEKARQGKLSLEEMTGGTFTLSNGGVFGSLFSTPILNPP
QTAILGMHKIQDRPMAVNGQVVILPMMYLALSYDHRLIDGKEAVQFLVTIKDLVEDPTRL
LLEI
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaattgaaatcaaggcaccccaatttccggaagcggttgctgatggcacc
gtggccacgtggcacaaaaaagtaggcgacaccgtaagccgtgacgaactacttgtagat
attgaaaccgataaagtggtgatggaaattgttgcgccgcacgatggcgtactcacgaag
attatcaagcaagcgggtgataccgtactgagccaagagttgattggaaaactctctgaa
acgggggcaggccatacgcatacggagagtgctcaagaccaacctcaagctgcggcccaa
actgccgcgtcggatgaggctgtcgatgacgcgtgggggccagcggttcgcaagctgatt
gcagataacaaaatcgacgcaaacaaagtgaccggtacgggtaaaggtggccgaatcacg
aaagaagatgtcctgaactatttgtcatcttcccagaccaaaacggcagcggcatcaagc
cccgcagccacatcggtatcggcggtatcccctagcgctccacaaactgcaccagctgcg
cccgcagccagcgttgccgcgtttgcagcagatgatcgcgtagaaaagcgcgtgcctatg
acgcgcctacgtgctcgaattgcagagcgccttgtgagtgcgcagcataatgctgccatg
ttgaccaccttcaacgaagtcaacatgaagccgatcatggatatgcgcaaaaactacaaa
gatgcgtttgaaaaagcgcacggtgtacgtttaggttttatgtctttatttgtgcgcgct
gcggtagaggcgctcaaacgtttcccctcagtaaacgcatccattgatggtaacgatatc
gtgtaccacggttactacgacgttggggtggcggtgtcctccgagcgtggcctcgtggtg
ccggtgatgcgtgatgtcgataaaatgggtttttctgaggtggaaggcaaaattgccgag
tatggtgagaaggcgcgccaaggcaagctatctcttgaggagatgacgggcggcacattc
accttgtcgaatggtggagttttcggttcgctattttcaacgcctatcttgaacccaccg
cagaccgcaattctcggaatgcacaaaattcaggatcgcccgatggccgtcaatggtcag
gtcgtgattttgccgatgatgtacttggcgcttagctacgatcaccgcctgattgatggc
aaggaagcagtacaattcctcgtgaccatcaaggatctggtagaagatccgacccgcctg
ttgctggagatttaa

DBGET integrated database retrieval system