KEGG   Gamma proteobacterium HdN1: HDN1F_15630Help
Entry
HDN1F_15630       CDS       T01300                                 

Gene name
succ
Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDN1F_15630 (succ)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_15630 (succ)
   00640 Propanoate metabolism
    HDN1F_15630 (succ)
   00660 C5-Branched dibasic acid metabolism
    HDN1F_15630 (succ)
Enzymes [BR:gpb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HDN1F_15630 (succ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1990219..1991385
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKKLFAQYGLPVSKGVAAQSVDAAVAAAKEIGGDKWVVKAQVHAGGRGKAGGV
KLVTDKEEIRAFARKLLGTNLVTYQTDERGQPVNTILVETCTDIEKELYLGAVLDRGSRR
VVFMASTEGGVEIEKVAHDTPEKILKVAIDPLVGAQPYQGRVLGYQLGLNSNQVKQFVNI
FMGLAKIFEEKDCSIIEVNPLVITKEGNLHCLDAKVVLDGSALFRHPDMEALYDPTQEDE
RERIAAQWSLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGRPANFLDVGGGATKERVTE
AFKIILSDSNVQAVLVNIFGGIVRCDLIADGIIGAVQEVGVKVPVVVRLEGNNADLGAKK
LADSGLNIIAASGFNDAAEKVVKAAAGV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaagcaaaaaagctatttgctcagtacggcttgcccgtctct
aaaggagtcgctgcgcagtctgtggatgcggcggttgctgctgccaaagaaattggtggc
gacaagtgggtggtaaaagcacaggtgcatgccggcggccgtggtaaggcaggtggcgtc
aagcttgtcactgataaagaagaaattcgtgcgtttgcgcgcaaattgctgggcacaaac
ctcgtcacttaccaaaccgacgagcgcggccagccagtgaacaccattctggttgaaact
tgcaccgacattgaaaaagagctctacctaggtgcagtactggatcgcggaagccgccgc
gttgtgtttatggcatctaccgaaggtggcgtagaaatcgagaaggttgcccacgatacg
ccagaaaaaattctcaaagtggccattgatccgcttgtaggcgcacagccatatcaaggc
cgcgtgcttggttatcagctcggtctgaacagcaaccaagtgaagcagttcgtgaatatc
ttcatgggtctggcaaagattttcgaagaaaaagactgctccatcatcgaagtcaatcct
ttggtaattaccaaagaaggcaacctgcactgcctagacgcaaaagttgtgttggatggc
agcgcattgttccgccatcctgatatggaagcactctacgaccccacgcaagaagatgag
cgtgagcgcatcgcagcccagtggagcctgaactatgttgcgctcgaaggcaacattggc
tgcatggtgaatggtgcgggcctcgcgatggctaccatggacatcatcaagctcaagggc
ggccgcccagcaaacttcctcgacgtaggcggtggtgcaaccaaagagcgcgtaacggaa
gctttcaagatcattctgtcagacagcaacgtgcaagctgtgctggtgaatatctttggc
ggaatcgtgcgttgtgacctgattgcagacggcattatcggcgcagttcaggaggtaggc
gtaaaagtaccggttgtggttcgtctagaaggcaataacgccgatcttggcgccaagaaa
ctagccgatagtgggctgaatattatcgctgccagcggatttaacgatgctgcagagaaa
gttgtcaaagcggcagcgggagtttaa

DBGET integrated database retrieval system