KEGG   Gamma proteobacterium HdN1: HDN1F_16280Help
Entry
HDN1F_16280       CDS       T01300                                 

Gene name
trpB2
Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDN1F_16280 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDN1F_16280 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDN1F_16280 (trpB2)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HDN1F_16280 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2061248..2062375
Genome map
AA seq 375 aa AA seqDB search
MAALDELEEIFTRLWRDPDFQAAFDRDLAHYVGRPSPLYFAERWTRETGGANLYLKREDL
NHTGAHKINNTIGQALLAKHTGKQRLIAETGAGQHGVATATIAARLGLECEIFMGAEDIQ
RQSLNVYRMKLLGAKVRAVTSGTRTLKDAMNEAMRDWVTNVDTTFYIIGTVAGPHPYPLL
VREFQSVIGREARQQCLEQIGHLPDALVACVGGGSNAIGLFHPFLADKGVAMYGVEAAGR
GLETGEHAAPLNAGKPGVLHGNRTYLMQDADGQILPTHSVSAGLDYPGVGPEHSWLKDCG
RAEYVPITDQEALHAFRELTRIEGIMPALESSHAVAYASKLAKTLGKGKDIIVNLSGRGD
KDIHTIARIDGISLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctggatgagctggaggaaatctttacccggctctggcgcgaccctgatttt
caggctgcctttgaccgcgatcttgcccactatgtaggccgcccctcgcctttgtatttt
gccgagcgctggacgcgcgagactggcggcgcaaacctctacctgaagcgcgaagacctc
aatcacaccggcgcgcacaagatcaataacaccattggccaagcgctgctcgccaaacac
accggcaaacagcgcctcatcgccgaaaccggcgctgggcagcacggtgttgccactgcc
accatcgcggcacgactgggccttgagtgcgaaattttcatgggcgcagaagacatccag
cgccagtcactcaacgtctaccgcatgaaactgctcggtgcaaaagtacgcgccgtgacc
tctggcacccgcacgctgaaagacgccatgaacgaagccatgcgcgattgggtcaccaac
gtagacaccaccttctatatcatcggcaccgttgctggcccgcacccctatccgctgtta
gtgcgtgaattccagagcgtgattggccgcgaagcccgtcaacaatgcttggagcaaatt
gggcacctgccagacgctctcgtcgcctgcgtaggtggcggctccaatgcaatcggcctg
tttcacccctttctcgccgacaagggcgtcgcgatgtacggtgttgaagccgcaggccga
ggcttggaaaccggcgaacatgcggcacccttgaatgctggaaagcccggcgtactacac
ggcaaccgcacctatctaatgcaggatgccgacggccagattttgcccacacattccgtc
tccgccggcttggattaccccggcgtcggccccgaacactcttggctaaaagactgcggc
cgcgctgaatatgtgcccatcaccgatcaggaagccctccacgctttccgcgaactcacg
cgcatcgaagggatcatgccagcgctagaatccagccatgccgtagcctatgccagtaag
ctggccaaaactctcggcaaaggcaaagacatcatcgttaatctctccggtcgcggagac
aaagacatccatacaattgcccgcattgacggcatctcactgacttaa

DBGET integrated database retrieval system