KEGG   Gamma proteobacterium HdN1: HDN1F_16280Help
Entry
HDN1F_16280       CDS       T01300                                 

Gene name
trpB2
Definition
Tryptophan synthase, beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gpb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gpb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gpb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2061248..2062375
Genome map
AA seq 375 aa AA seqDB search
MAALDELEEIFTRLWRDPDFQAAFDRDLAHYVGRPSPLYFAERWTRETGGANLYLKREDL
NHTGAHKINNTIGQALLAKHTGKQRLIAETGAGQHGVATATIAARLGLECEIFMGAEDIQ
RQSLNVYRMKLLGAKVRAVTSGTRTLKDAMNEAMRDWVTNVDTTFYIIGTVAGPHPYPLL
VREFQSVIGREARQQCLEQIGHLPDALVACVGGGSNAIGLFHPFLADKGVAMYGVEAAGR
GLETGEHAAPLNAGKPGVLHGNRTYLMQDADGQILPTHSVSAGLDYPGVGPEHSWLKDCG
RAEYVPITDQEALHAFRELTRIEGIMPALESSHAVAYASKLAKTLGKGKDIIVNLSGRGD
KDIHTIARIDGISLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctggatgagctggaggaaatctttacccggctctggcgcgaccctgatttt
caggctgcctttgaccgcgatcttgcccactatgtaggccgcccctcgcctttgtatttt
gccgagcgctggacgcgcgagactggcggcgcaaacctctacctgaagcgcgaagacctc
aatcacaccggcgcgcacaagatcaataacaccattggccaagcgctgctcgccaaacac
accggcaaacagcgcctcatcgccgaaaccggcgctgggcagcacggtgttgccactgcc
accatcgcggcacgactgggccttgagtgcgaaattttcatgggcgcagaagacatccag
cgccagtcactcaacgtctaccgcatgaaactgctcggtgcaaaagtacgcgccgtgacc
tctggcacccgcacgctgaaagacgccatgaacgaagccatgcgcgattgggtcaccaac
gtagacaccaccttctatatcatcggcaccgttgctggcccgcacccctatccgctgtta
gtgcgtgaattccagagcgtgattggccgcgaagcccgtcaacaatgcttggagcaaatt
gggcacctgccagacgctctcgtcgcctgcgtaggtggcggctccaatgcaatcggcctg
tttcacccctttctcgccgacaagggcgtcgcgatgtacggtgttgaagccgcaggccga
ggcttggaaaccggcgaacatgcggcacccttgaatgctggaaagcccggcgtactacac
ggcaaccgcacctatctaatgcaggatgccgacggccagattttgcccacacattccgtc
tccgccggcttggattaccccggcgtcggccccgaacactcttggctaaaagactgcggc
cgcgctgaatatgtgcccatcaccgatcaggaagccctccacgctttccgcgaactcacg
cgcatcgaagggatcatgccagcgctagaatccagccatgccgtagcctatgccagtaag
ctggccaaaactctcggcaaaggcaaagacatcatcgttaatctctccggtcgcggagac
aaagacatccatacaattgcccgcattgacggcatctcactgacttaa

DBGET integrated database retrieval system