KEGG   Gamma proteobacterium HdN1: HDN1F_16290Help
Entry
HDN1F_16290       CDS       T01300                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDN1F_16290 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDN1F_16290 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDN1F_16290 (trpA)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HDN1F_16290 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2062393..2063199
Genome map
AA seq 268 aa AA seqDB search
MSRIPQVMASLRATGRKALIPFFTAGDPAPAYTPEIMHALVQGGADIIELGVPFSDPMAD
GPVIQLANERALEHHVGLHQVLDIVRTFRQTNQTTPVVLMGYLNPVEAYGYDAFATDAAS
AGVDGVLTVDLPPEAAEPLKSALAREQIDSIFLIAPTTLPQRVAKIAAEASGYLYYVSLK
GVTGAANLDIDSVREKLETIRNTTDLPVAVGFGIKDANTATHVGALADGVVVGSALINIV
AAHQERPEKIAPAISAFLKDLRQALDKL
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcattccgcaagttatggcctcactccgcgcaacaggccgcaaagcgctgatt
cccttttttacagcgggcgaccctgcgcctgcctacacccccgaaatcatgcatgcgctg
gtgcagggcggtgccgacatcattgagctgggcgtaccgttttccgacccaatggctgat
ggccccgttatccaactcgcgaacgaacgtgcgctggaacatcacgttggtttgcaccaa
gttctcgacatcgtgcgcacgtttcggcaaaccaatcagaccactccggtggtgctcatg
ggctatctgaaccccgtagaagcctatggttacgatgctttcgctaccgatgcagcaagc
gcaggcgtcgatggtgtcttgacggtagacctgccacccgaagcggccgagccgctcaaa
tcggcgctcgcgcgcgaacaaattgactccatctttttgatcgcgcccaccaccttaccc
cagcgtgtggccaagatcgcagcagaggcgagcggttatttatattatgtatcgctcaaa
ggcgtaaccggcgcagccaacctcgatattgactcagtgcgcgagaaactggaaacaatt
cgaaatactaccgatttgcctgtcgccgtcggctttggtatcaaggacgccaatactgct
acccacgtcggcgcgctcgcggatggcgtggtggtaggcagcgctttgatcaatattgtg
gccgctcatcaagagcgccccgaaaagatcgcacctgccataagcgcttttctcaaggat
ttgaggcaagcattggacaaactgtaa

DBGET integrated database retrieval system