KEGG   Gamma proteobacterium HdN1: HDN1F_19250Help
Entry
HDN1F_19250       CDS       T01300                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     HDN1F_19250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2390711..2392504
Genome map
AA seq 597 aa AA seqDB search
MSAPEGDWKVKYLDLLDELERTRQLEKKRIEVLRKGVVRVSVAADGQDDALDAKLAELRA
AMRAQGEVLELEPLIFRLENAVKALDYQRKHAGDEIAQLLSEHVERYEQLPLSRTGKNLL
RKFRQEFPELLADKSKHPSLWRAYTHLTDTVLAHLQERLSASGEPVQPGFFQRLLGGKAV
KAQEGPTENHLESQGLEPQGLEPHEDSAVPEVPRAPTSEDVDIGIESGVLHAAHTNGGQE
PVADGRLVSNQEEIRARIRRALLQLLEQVDIPAELLPRKERLIEHLAETFAWDHLPNLLV
EAGELFSMLRNHGQREFEAFLRTLHERLQEIQEFLAASKAGQEAAKESREQLDADVRSNL
QQLQTSVQVDKGMPAIRDEIESVMKHILGVMDEFRTKETGRQEAMLGHIHTVVERMHVME
REALELKQALEQQQSKAMTDALTGLPNRQAYDDYILREFSRWKRRGHALSMAVIDIDFFK
RINDTLGHLRGDKVLKLVAREIQDCVRSEDFVARYGGEEFVALLPDTDQDAGRTAMEKVR
QHIEVCPFNFHNQRVVVTVSIGVAQFQEGDSIESVFDRADQALYRAKGGGRNRVELG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctccagaaggcgactggaaagtaaaatacctagacctgcttgatgagcttgag
cgcactcggcagttggaaaaaaagcgcattgaagtgcttcgcaaaggggttgtgcgagtc
agcgttgcagccgatgggcaggatgacgcgctcgatgcaaagctggccgagttgcgtgcc
gcgatgcgcgcacagggcgaagtgttggagttggaaccgctgatctttcgcctcgaaaac
gcggtcaaagcgcttgattaccagcgcaagcacgccggcgacgagattgcgcaactgctg
tccgaacacgtagagcgttatgagcagctgcctctctctcgaacgggtaagaatctgctt
cgcaagtttcgccaagagttccccgagttgcttgccgacaagtctaagcatccatcgcta
tggcgagcgtatacacacttaacggataccgttttggcgcaccttcaggagcgcttaagc
gctagcggagagccggttcagccgggcttctttcagcgtctgttaggcgggaaagcggtg
aaggcgcaagagggccctaccgaaaaccacctcgaatcacagggcctcgaaccacagggc
ctcgaaccacatgaggatagtgcggtgccggaagtaccgcgagcgccgacttcagaagat
gtagatattggcattgaatctggagttttgcatgcggcacataccaacggtgggcaggag
cccgttgccgatggccgcctcgtttcgaaccaagaagaaattcgcgcgcgtattcgtcga
gccttgttgcagcttttggagcaagtggatattcctgcggagttgctgccgcgcaaagag
cgtttgatcgaacatcttgcggagacattcgcatgggatcacctgcccaacctgttggtg
gaggcgggtgaacttttttccatgctaaggaatcatggtcagcgtgagttcgaagctttt
ttgcgaacgctgcatgagcgtttgcaagaaattcaggaatttctggctgcaagcaaagca
ggccaagaagccgcaaaggagagccgcgaacagcttgatgccgatgtgcgcagtaacttg
caacaactgcaaaccagtgttcaggtagataaaggaatgccggccattcgcgacgaaatt
gagtccgtaatgaagcacattcttggcgtgatggacgaatttcgcaccaaagaaactggc
cgccaagaagcgatgcttggccatatccataccgtcgttgaacggatgcatgtcatggag
cgtgaggcactcgaattgaagcaagccttggaacagcaacagtccaaagcaatgacggat
gcgctaacggggctccccaaccgacaagcctatgacgactacattctcagagagttttcg
cgctggaagcggcgaggccacgcgctttccatggcggtgatcgacatcgacttttttaag
cgcatcaacgatacgctcggccacctgcgtggtgacaaagtgctaaagcttgttgcgcga
gagatccaggattgcgtaagaagcgaagacttcgtggcgcgctacggcggcgaggaattt
gttgcgctcttacctgatactgatcaggatgcgggccgcacagcgatggaaaaagtgcgt
caacatatcgaggtttgcccgtttaactttcataatcagcgggttgtcgttaccgtgtcg
atcggtgtcgcacagtttcaagaaggagatagcattgaaagtgtcttcgatcgcgcggat
caggcgctttatcgtgcaaaaggcggcggccgtaaccgcgtggaacttggctag

DBGET integrated database retrieval system