KEGG   Gamma proteobacterium HdN1: HDN1F_19870Help
Entry
HDN1F_19870       CDS       T01300                                 

Gene name
tesI
Definition
3-ketosteroid-delta4(5alpha)-dehydrogenase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    HDN1F_19870 (tesI)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     HDN1F_19870 (tesI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2471113..2472996)
Genome map
AA seq 627 aa AA seqDB search
MTSTSATQLNDLPGTQVKEPLLIGNPEALDWTARYDVVVVGLGAAGVAAAIEAADRGSKV
AFVDCFNGGGTTARSGSVMYAGGGTALQERLGVKDDPDIMFRYLQHEVKGAVTDATLRRF
CENSPENFAWAERNGVSYSGALFAKKTSYPVPGYSLYFSGNELIYSESAKPAPRGHLADG
IKKFTAFGPAFIAPLIRSALKKGVFPQTQARVTRLVCTHSGEVVGVEAQQIPAKTAANYK
HRYWSTLAAYAQIYYPPAARYFRAKIAALERRYAVTVRFQARSGVVLATGGFILNKELTE
KYLPKYRRAMRLGTPGDLGSGLALGVSAGGIAERLSTATAWRFINPPVDWPKGALVNLQG
KRYINEAMYGATIGTTMMEENNGEAVLILDKPLFDASVANLNLQNTRLVTLLQAKSAVRI
AKSADTLEALAAKCKIDPQGLRETITQYNASANGSAPDAFGKAREDMAAIEQGPFYALNM
SVGKGDITSVITLGGLRVCEGTGAVFKADGSGLVPGLYAAGRTAIGVASNAYISGLSIAD
GVFSGRRAGEFAAKRRQEIYAQEITSTDAAEGSDGASKCPVAHGTDNMAHTATNTGSPAH
DAGAGKCPIDHSSAQKAPAEGQEKIEQ
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcacatcagccactcaattaaacgatcttcccggcactcaggtaaaagagccc
ctcttgattggcaatcccgaggcgctagactggacggcccgctacgacgtagtcgttgta
ggtcttggcgctgctggcgtcgcagcggcaattgaagcggccgatcgcggcagcaaagtc
gcttttgtggattgcttcaacggtggcggcacaaccgcacgcagtggcagcgttatgtac
gcaggcggaggcacagccttgcaggagcgattgggcgtaaaggacgatccagacatcatg
tttcgctaccttcagcatgaagtaaaaggtgcggttacggatgcaactctgcgacgcttt
tgcgagaacagcccagaaaactttgcttgggcagagcgtaatggcgtgtcgtacagcggc
gcattattcgcaaaaaaaaccagttacccagtgcccggctacagcctgtatttttccggc
aacgagctgatttattcagaaagcgcaaaacccgcaccacgcggccatcttgccgatggc
atcaagaaattcaccgcatttgggcctgcttttatcgccccgctgattcgatccgccctg
aaaaagggtgtttttccgcaaacgcaagcgcgcgttacgcggctagtgtgcactcattca
ggggaagtcgtcggcgttgaggcgcagcaaattcctgcaaaaaccgccgccaattataaa
caccgttactggtccacgctcgcggcttacgcacagatttattatccgcctgctgcaaga
tactttcgcgccaaaatcgcggctcttgagcgtcgttatgcagtgacggtacgttttcag
gcccgcagcggtgtcgtgcttgcgacgggcggtttcatcctgaacaaagaactcaccgag
aagtatttgccgaaatatcgccgcgccatgcgccttggcacgccgggcgatcttggctct
ggccttgccttaggtgtgagcgcaggcggaatcgccgaacgcctgagcactgcaactgcc
tggcgctttatcaatccacccgtggattggcccaaaggcgcactagtaaacctgcaaggt
aagcgttacatcaatgaagccatgtacggcgccaccatcggcaccaccatgatggaagaa
aacaatggcgaagcggttctgattctcgacaagccgttattcgacgccagcgttgccaat
ctaaacttgcaaaacacccgcctagtaacgctgctgcaggcgaagtctgccgtacgaatc
gcaaaatctgccgatacgctggaagcactcgcagcgaaatgcaaaattgacccacaaggc
ttgcgagaaaccatcactcagtacaacgcctccgcaaacggaagcgcgcccgatgcgttt
ggcaaggcgcgtgaagatatggccgccattgagcaagggcctttttacgcgctaaacatg
tccgtgggcaaaggcgacatcacctcggtgattactttgggcgggctgcgcgtctgcgaa
ggtaccggcgccgtattcaaggccgatggcagcggcctagttcctggcttatatgcagcg
ggccgtaccgccattggagtggcatccaatgcctatatcagcggcctgtcgattgctgat
ggcgtgttttctgggcgccgcgccggtgagtttgccgccaaacgccgacaagaaatctat
gcacaggaaattacctcaacggatgcggccgagggtagcgacggcgcaagcaaatgccca
gtggctcacggcaccgacaatatggctcacaccgctaccaatacgggaagccctgctcac
gacgccggcgccggcaaatgccccatagaccattcatctgcccaaaaagcacccgcagaa
ggccaggaaaaaatcgaacaatga

DBGET integrated database retrieval system