KEGG   Gamma proteobacterium HdN1: HDN1F_20020Help
Entry
HDN1F_20020       CDS       T01300                                 

Gene name
folK1
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HDN1F_20020 (folK1)
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HDN1F_20020 (folK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2489069..2489590)
Genome map
AA seq 173 aa AA seqDB search
MNLPSPVTAYIGLGSNLQNPAAQLECALQALRKQPGILMVKASSFYRSKAVGPGDQPDYV
NAAVQLETTLSPIGLLDALQSIENTQGRVRGEIRWVARTLDLDLLLYGDQTIQHSRLQVP
HPRMTERAFVLKPLLELAPTLRLPDGQALKPHLDACAGDDVSLLPNGSTDTWP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttgccttctcccgttacagcctacattggcctcggtagcaacctgcaaaaccct
gctgcgcagcttgaatgcgcactgcaagcgctccgcaagcagccggggattctcatggta
aaagcctcgtcattttatcgctcaaaagcggtgggcccaggcgatcagcccgattacgta
aacgctgcagtgcagctcgaaaccacactctctcccattggtctcctagacgctttgcag
agtatcgaaaatactcaaggccgagtgcgcggtgaaattcgctgggtcgcgcggacgctg
gatcttgatctgttgctttacggcgatcaaaccatccagcattcacgtctgcaagtgcca
catccgcgtatgacagagcgcgcttttgtgctaaaacctctgctggaactcgcccccaca
ctacgcttaccagatgggcaggcactaaagcctcacctagatgcctgcgcgggcgacgac
gtttctctcttaccgaacgggagtacagacacatggccgtaa

DBGET integrated database retrieval system