KEGG   Gamma proteobacterium HdN1: HDN1F_20690Help
Entry
HDN1F_20690       CDS       T01300                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HDN1F_20690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDN1F_20690
  Lipid metabolism
   00071 Fatty acid degradation
    HDN1F_20690
  Amino acid metabolism
   00350 Tyrosine metabolism
    HDN1F_20690
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HDN1F_20690
   00626 Naphthalene degradation
    HDN1F_20690
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HDN1F_20690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2572274..2573458)
Genome map
AA seq 394 aa AA seqDB search
MSKPYFEFFCPVKTIAGHKALEHMPFELQALGSSRPLIITDVGVRKAGLLEQVLPVFKEA
GTEIADIYDNVPPDSSTDTVTEIAALYRSKNADSIIAIGGGSVIDTSKGVNILVSEGGDD
IHKYSGAGVLTRPLKPLFVVPTTAGTGSEVTAIAVVSDCKTGAKLPFASQFLLPNAAVLD
PRMTLTLPPAITAATAMDAMTHAMESYICLAKNPLSDAYGTQAIRKISENILHVMDNPQD
ANGRLELALAATMAGIAFSNSMVGLVHALGHALGAICHLPHGICMNIFLPYVLEYNMETS
SELIGELLLPLAGPEVYASTPKPMRAERTLQRVRALRDELYERVKLPRRLSETGKVTRDQ
IPQLAKLSLDEGPVLFNPKEMELAEAIALLERAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagccttattttgaatttttctgccccgtaaaaacgatcgcagggcacaaagca
ctagagcacatgccctttgaactgcaagcattaggttcatcacgcccgctgatcattacc
gacgttggcgtaagaaaggcaggcttattagaacaagtgctccctgttttcaaagaagcc
ggcactgaaattgccgatatttacgataacgtaccgccagattcctccacggacaccgtc
acagaaattgccgcactgtaccgcagcaaaaacgccgactccatcattgccatcggcggc
ggctccgtcattgacaccagcaaaggcgtaaatatcttagtctccgaaggtggcgatgat
atccacaaatactccggtgctggcgttctcacccgccccttaaaaccgctatttgtggtt
ccaacgaccgccggcaccggctctgaagtgaccgcaattgcagtggtctccgactgcaaa
acgggcgccaaactaccctttgcctcacagtttttgctccccaatgcggccgtactcgac
ccacgcatgacgctcactttgccacccgccatcaccgcagcaacggcgatggatgcgatg
acacatgcaatggaatcctatatttgcctcgccaaaaaccccctgagcgatgcctacggc
acacaggcgatccgcaaaatcagcgaaaacatcctgcacgtgatggacaatccacaagac
gccaatgggcgcctggagcttgcacttgccgcgaccatggcaggcatcgcattctccaac
tccatggtaggtctggtacacgcgctgggccacgccttgggcgcaatatgccaccttcca
cacggcatctgcatgaacatcttcttgccgtatgtgcttgaatacaacatggaaaccagc
agcgaactgatcggcgagctactcctgccgctggccggcccggaagtctacgcatcaacg
cccaagcccatgcgcgccgaacgcacgctgcaacgtgtgcgtgccctgcgtgatgaactg
tacgagcgcgttaaactcccccgccgcctctcagagacgggcaaagtaacacgtgaccag
atccctcagcttgcaaagctttcgctagatgaaggccccgttctctttaaccccaaagaa
atggagctggctgaagccattgcgctgcttgagcgggcttggtaa

DBGET integrated database retrieval system