KEGG   Gamma proteobacterium HdN1: HDN1F_21110Help
Entry
HDN1F_21110       CDS       T01300                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gpb01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gpb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2625056..2625856
Genome map
AA seq 266 aa AA seqDB search
MSTPTVLKKILARKVEEVAERRRNVSEAELQKRAKSADQPRGFVNAIRQKLDVGESAVIA
EIKKASPSKGVIRENFLPAEIAKSYARAGAACLSVLTDKDFFQGDERYLQEARAACDLPV
IRKDFLVDTWHVVEARAIGADCILLIVAALDDVQLRDFSQCAQSLGMDVLVEVHDREELE
RALKLNTTLVGINNRNLHTFDVTLDTTLGLLSAIPKDRIVVTESGILVPEDVALMRRNQV
SAFLVGEAFMRAEDPGSELQRLFQRQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccaaccgtactgaagaaaatcttggctcgaaaggtagaggaagttgccgaa
cgccgtcggaatgtgagcgaggccgaactgcaaaaacgcgccaaaagcgctgatcagcca
cgcggctttgtaaatgcaattcgccaaaaactggatgtcggcgaatcagccgtgattgcg
gaaatcaagaaagcatcccccagcaagggcgtgatccgagaaaatttcctgcctgcagaa
attgccaagagctacgcgcgcgcgggtgcagcgtgtttgagcgttctcacagacaaagat
ttttttcagggcgatgagcgctatttgcaagaagcgcgcgcggcctgcgatttgccagtc
atccgcaaggattttctggtggatacttggcatgtggttgaagcgcgcgccattggcgca
gactgcattttgctgatcgttgcggctttggatgatgtgcaacttcgtgatttttcgcag
tgcgcacagtcattgggcatggatgtattggtggaggttcacgatcgtgaggagcttgaa
cgtgcattaaagcttaataccacgcttgttggaatcaacaaccgcaatttacacaccttc
gacgttacgctggataccacgcttggtctgctgagcgccattccgaaagatcgcattgtc
gttaccgagagcggaattttggtgccggaagacgttgcactcatgcgacgtaatcaggta
agcgcatttctggtgggcgaggcatttatgcgcgcagaagacccgggcagtgaattgcag
cgtttgtttcagcgccagtaa

DBGET integrated database retrieval system