KEGG   Gamma proteobacterium HdN1: HDN1F_21110Help
Entry
HDN1F_21110       CDS       T01300                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01130  Biosynthesis of antibiotics
gpb01230  Biosynthesis of amino acids
Module
gpb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDN1F_21110 (trpC)
Enzymes [BR:gpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HDN1F_21110 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBL45694
UniProt: E1VLK2
Position
2625056..2625856
Genome map
AA seq 266 aa AA seqDB search
MSTPTVLKKILARKVEEVAERRRNVSEAELQKRAKSADQPRGFVNAIRQKLDVGESAVIA
EIKKASPSKGVIRENFLPAEIAKSYARAGAACLSVLTDKDFFQGDERYLQEARAACDLPV
IRKDFLVDTWHVVEARAIGADCILLIVAALDDVQLRDFSQCAQSLGMDVLVEVHDREELE
RALKLNTTLVGINNRNLHTFDVTLDTTLGLLSAIPKDRIVVTESGILVPEDVALMRRNQV
SAFLVGEAFMRAEDPGSELQRLFQRQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgccaaccgtactgaagaaaatcttggctcgaaaggtagaggaagttgccgaa
cgccgtcggaatgtgagcgaggccgaactgcaaaaacgcgccaaaagcgctgatcagcca
cgcggctttgtaaatgcaattcgccaaaaactggatgtcggcgaatcagccgtgattgcg
gaaatcaagaaagcatcccccagcaagggcgtgatccgagaaaatttcctgcctgcagaa
attgccaagagctacgcgcgcgcgggtgcagcgtgtttgagcgttctcacagacaaagat
ttttttcagggcgatgagcgctatttgcaagaagcgcgcgcggcctgcgatttgccagtc
atccgcaaggattttctggtggatacttggcatgtggttgaagcgcgcgccattggcgca
gactgcattttgctgatcgttgcggctttggatgatgtgcaacttcgtgatttttcgcag
tgcgcacagtcattgggcatggatgtattggtggaggttcacgatcgtgaggagcttgaa
cgtgcattaaagcttaataccacgcttgttggaatcaacaaccgcaatttacacaccttc
gacgttacgctggataccacgcttggtctgctgagcgccattccgaaagatcgcattgtc
gttaccgagagcggaattttggtgccggaagacgttgcactcatgcgacgtaatcaggta
agcgcatttctggtgggcgaggcatttatgcgcgcagaagacccgggcagtgaattgcag
cgtttgtttcagcgccagtaa

DBGET integrated database retrieval system