KEGG   Gamma proteobacterium HdN1: HDN1F_22450Help
Entry
HDN1F_22450       CDS       T01300                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HDN1F_22450 (dsbC)
Secretion system [BR:gpb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HDN1F_22450 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2776948..2777742
Genome map
AA seq 264 aa AA seqDB search
MFKARSTFWLWRAKFTMKGIKMKRHYLASVCFGFGVLATNVFAGEAEIKASLEASLPRVQ
IQSVAPTAVKDIYQVVLSSGQVLHTTADGKHFFAGDLISLEGNKIANVTEEWRAKNRVEA
LHSLKDKDLVVFPAKGAEKGELYVFTDVTCGYCIKFHSEVPELNRQGITVKYAAWPRAGV
SSDAGNTMRDVWCAADRQTAMTNAKSHKAVEHAKDSCTDQVIADQVKLGFALGVNGTPAV
FDKNGQKLGGYAPADVFVKALTQR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagctcgtagcacgttttggttatggcgtgccaaatttacaatgaaaggtata
aagatgaaacggcattatctggcgtcggtgtgtttcggttttggcgtattggcgaccaac
gtgttcgcgggagaggcagaaattaaggcttcgctcgaagcgtcgctgccgcgagtgcag
atccaatccgttgctcctactgcggtaaaagatatctaccaagtggttctgtcatcgggg
caagtgctgcatacgaccgcagacggcaaacacttttttgccggcgatctgatctcgtta
gaggggaacaaaatcgctaacgttaccgaagagtggcgcgccaagaaccgcgtagaagcg
cttcacagcctgaaggacaaggatttggtggtattccctgcaaaaggggctgaaaagggc
gagctctacgtttttactgatgttacttgtggttattgcatcaagtttcactctgaagtg
cctgagctaaaccggcaagggatcactgtaaaatatgcggcttggccgcgtgcgggggtc
agttcagatgctggaaacacgatgcgggatgtgtggtgcgctgcggatcgccaaacggca
atgaccaacgccaagtcccacaaagcggtggagcacgctaaggattcttgcaccgaccaa
gtgattgctgatcaggtcaagcttggttttgctttgggtgtaaacggcacgcctgcagta
tttgataaaaacggccagaagctcggtggttatgcgcctgcagacgtatttgtgaaggcg
cttacgcaacgctag

DBGET integrated database retrieval system