KEGG   Gamma proteobacterium HdN1: HDN1F_22470Help
Entry
HDN1F_22470       CDS       T01300                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HDN1F_22470 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDN1F_22470 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HDN1F_22470 (thrC)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HDN1F_22470 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2779295..2780380
Genome map
AA seq 361 aa AA seqDB search
MSVSPRYTGLIDKYRDRLPVRDNTRVISLGEGNTPLIRLHNIPKLIGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSRAIICASTGNTSAAAAAYAARAGITAFVLIPEGKIAMG
KLAQAMMYGAIILQIRGNFDEGMELVKQVASEAPVTVVNSINPFRLQGQKTASFEIVEEL
GAAPDYHCLPVGNAGNITAHWMGYSEYQKAGVSNSLPKMVGYQAAGSAPFLRGHMVDKPE
TVATAIRIGHPQSWDKAWNVQKESGGWFDELVDEEILQAQRLLAQHEGVFCEPASAASLG
GAIRDVKNGRIPEGSKIVCTLTGNGLKDPDTAISQCKNSVLLTIDATLDAVKSGILKNFA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgagtccacgctataccggcttgatcgacaaataccgcgaccgccttccggtg
cgcgacaatacccgcgttatcagccttggggaaggtaatacgccactgatccggttgcac
aatattcccaaactgatcggcaaagatgtcgatatttatgtgaagtacgaaggcttgaac
ccgacgggctcctttaaggatcgcgggatgaccatggcggtgaccaaggccgtagaagaa
ggcagccgcgcaattatctgcgcctctaccggtaatacttctgcggcggcagcggcttac
gctgcgcgcgctgggatcactgcgtttgtattgattccggaaggcaaaatcgcgatgggc
aagctggctcaagcgatgatgtacggtgcgatcattctgcagattcgcggcaactttgat
gagggcatggagcttgtgaagcaggtagccagtgaagcgccggttactgtggtgaactcc
attaacccgttccgcttgcaagggcagaaaaccgcctcttttgaaatcgtcgaagagctt
ggcgctgcgcctgattaccactgcttgccggtaggtaatgcagggaatattacggcacat
tggatgggatatagcgagtaccagaaggcgggcgttagcaattccctgccgaaaatggtt
ggctaccaagctgcaggctctgcgccatttttgcgcggccacatggtggataagcccgaa
acggttgcaacggcgattcgtatcggccatccgcaatcttgggacaaagcgtggaatgta
cagaaggagtcgggcggttggtttgatgagttggttgatgaagaaatccttcaagcccaa
cgcttgctggcccagcatgaaggtgtgttctgtgagcctgcgtctgcggcttctttgggt
ggcgcaattcgtgacgtgaaaaacgggcggattccggaaggcagcaagattgtttgtacc
ctgaccggcaacggtttgaaagatcccgacacggcgatttcgcagtgtaagaattcggtg
ttgctcaccatcgacgctacgctcgatgcggtcaaatccggaattctgaaaaattttgct
caataa

DBGET integrated database retrieval system