KEGG   Gamma proteobacterium HdN1: HDN1F_22930Help
Entry
HDN1F_22930       CDS       T01300                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HDN1F_22930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2826575..2829610
Genome map
AA seq 1011 aa AA seqDB search
MKLHFEPNLDYQMQAIEAVCDLFRGQEVCRTEFTVTMKAPAPTEPDLFPGTQPEQMTLGM
AESDLGVGNRLTLLDDELHKNLADIQLRGGLAPSGALASGDFTVEMETGTGKTYVYLRTI
FELNKRYGFSKFVIVVPSVAIKEGVYKTLQITEDHFKGLYAGVPFDYFLYDSSKLGQVRN
FATSSNIQIMVVTVGAINKKDVNNLYKDSEKTGGEKPIDLIKATRPILIVDEPQSVDGGL
KGAGKEALDAMNPLCTLRYSATHVDKHHMVYRLDAVDAYERKLVKQIEVASATIEAAHNK
PFVRLLSTSNKRGTISARIELDVATANGVKRQEVTVQDGDDLEQTGKRPIYADFRIGEIN
TAKGEEFMELRYPGGEVFLSPGQAHGDVDALAVQREMIRRTIREHLDKEKRLRPMGIKVL
SLFFIDAVDRYRQYDADGNPVKGDYARIFEEEYKRAAKLPAYQSLFAEIDLDTAAEDVHN
GYFSIDKKGGWSDTAENNAGNRENAERAYNLIMKEKEKLLSFATPLKFIFSHSALKEGWD
NPNVFQICTLRDIQTERERRQTIGRGLRLCVNQSGERVRGFDVNTLTVIATENYEQFAEN
LQKEIEADTGIRFGIVEPHQFAAIAVAGADGQAVALGVEKSKALWEHLKAAGHIDAKGKV
QDSLKKALKEGTLVLPAEFDAQKSQIAEVLRKVSGRLEIKNADERKQVPLRKGQDGKAIA
LSDEFKALWDRIKHQTTYRVQFDNAKLITNCISALQKAPAIAKARLQWRKADIAIGKAGV
QATEKSGAATVVLDETDIELPDLLTDLQDRTHLTRRTITSILTGSGRLDDFKRNPQQFIE
LAAETINRCKRMALVDGIKYQKLGDQHVYAQELFEKEELTGYLKNMLMDTQKSIYEHVVY
DSTTERDFADALEKNDAIKLYAKLPGWFKVPTPLGSYNPDWAVLVEEDGAQRLYFVVETK
SSLFTDDLRDKESAKIECGKAHFHALAVGENPARYVVARSVGDLLTEAAKG
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccactttgagccgaacctcgactaccagatgcaggccattgaggccgtgtgc
gacctgttccgtggccaggaggtgtgccgcaccgagttcacggtgacgatgaaggcgcca
gcgccaacagaaccggatctgtttcccggcacgcaaccagagcaaatgaccctgggcatg
gccgagtctgatctgggtgtgggtaaccgcctgaccctgctggatgatgagctgcacaag
aatctggccgacattcagttgcgtggcgggctggcaccgtccggcgcgctggcgtcgggt
gattttaccgtggagatggaaaccgggaccggcaagacctatgtctacctgcgcaccatc
ttcgagctgaacaagcgttatggcttcagcaaattcgtgattgtggtgccctcggtagcc
atcaaggagggcgtctacaagaccctgcagatcaccgaggatcacttcaaggggctctat
gccggggtgcccttcgattatttcctgtacgactccagcaagctcgggcaggtgcgcaac
tttgccaccagttcaaacattcagatcatggtggtgacggtcggcgccatcaacaagaag
gacgttaataacctttacaaggacagcgagaagaccggtggtgaaaagcccatcgacttg
atcaaggcgacccggcccattctgattgtcgatgagccgcagagtgtggacggcggcctg
aaaggtgcgggaaaggaagccctggatgcgatgaatccactctgcaccctgcgctattcg
gcaacccacgtggacaagcaccacatggtgtatcgcctcgacgcggtagacgcttatgag
cgcaagctggtcaaacagattgaagtggcctcggcgaccattgaggcagctcacaataaa
ccctttgtacggctgctatcgaccagtaacaagcgcgggaccatcagtgcccggattgag
ctggatgtggctacagccaatggcgtcaagcggcaggaggtcactgtccaggatggtgac
gatctggagcagacgggcaagcgtccgatttatgccgatttccgtattggcgagatcaat
acggccaaaggtgaggagttcatggaactgcgttacccgggtggcgaggtgttcctgtcg
ccgggtcaggcacacggtgatgtggatgcgctggccgtgcaacgcgaaatgatccgtcgc
accatccgtgaacatctggacaaggaaaagcgcctgcggcccatgggcatcaaggtgctg
tcactgtttttcattgatgcggtggaccgataccggcagtacgacgcggacggcaacccg
gtcaaaggggactatgcacgcatctttgaagaggaatacaagcgtgctgcaaagctgccg
gcttaccagagtctgtttgccgagattgatctggatacggcggccgaggatgtgcataac
ggctatttctcaatcgacaagaaaggtggctggtcagataccgcggagaacaatgccggc
aaccgtgagaatgccgagcgtgcgtacaacctgatcatgaaggaaaaggaaaagctgctg
tcctttgctacgccgctcaagttcattttctcccactcggccctaaaggaaggctgggac
aacccgaacgtgtttcagatctgcacgctgcgagacatccagaccgagcgtgagcgacgc
cagaccattggtcgcggattgcggttgtgtgtcaatcaatccggcgagcgggtgcggggc
ttcgacgtcaacacgctcactgtgattgcgaccgaaaactacgagcagttcgccgagaac
ctgcaaaaggaaatcgaggcagacacgggtatacgcttcggtatcgttgagccgcaccag
ttcgcggccattgcagtagcgggggctgacggtcaggcagtggccctgggtgtcgagaag
tcaaaggcactatgggagcatttgaaggccgcaggccacattgacgccaagggcaaggtg
caggattcactgaaaaaagccctcaaggaaggcaccctggtgctacccgccgagtttgat
gcgcagaagagccagattgccgaggtgctgcgcaaggtgtcgggccgcctggagatcaag
aatgccgatgagcgcaaacaggttccactgcgcaaaggccaggatggtaaggcgatagcc
ctgagtgacgagttcaaggcgctatgggatcgcattaagcatcagaccacctatcgcgtg
caatttgacaacgccaagctgatcactaattgcatcagcgccttgcaaaaggcgcctgcg
attgcgaaagcgcgcctgcaatggcggaaggccgatatcgccattggcaaggcgggcgtt
caggcgaccgagaaatcgggtgcagcgacggtggtgctggatgaaacggatattgagctg
cctgacttgctgacggacctgcaggatcgaacccatctgacccgccgcacgatcaccagc
atcctgactggaagtgggcgcctggacgacttcaagcgtaacccgcagcagttcatcgag
ctggccgccgagaccatcaatcgatgcaagcggatggccctggtcgacggcatcaagtac
cagaagttaggcgaccagcacgtctacgcgcaggagctgttcgagaaggaagagctcact
ggctatctcaagaacatgcttatggacacccaaaaatcgatctacgagcatgtggtgtac
gactcgacgacggagcgagactttgccgacgcgctggagaagaacgacgcgatcaagctg
tatgcaaaactaccaggctggttcaaggttccaaccccgctaggtagctacaaccccgac
tgggctgtgctggtggaagaggatggcgcgcagcgtctttacttcgtcgtggaaaccaag
agcagcctgtttaccgatgacctgcgggacaaggagagcgccaagatcgaatgtggcaag
gcgcatttccacgcactggcagttggcgagaatccggcacgctatgtggtggcgcgttca
gtgggcgacctgttgacggaagcggccaagggatag

DBGET integrated database retrieval system