KEGG   Gamma proteobacterium HdN1: HDN1F_24470Help
Entry
HDN1F_24470       CDS       T01300                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    HDN1F_24470
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     HDN1F_24470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3016025..3017731)
Genome map
AA seq 568 aa AA seqDB search
MPSKQEQAPPPTTETAAPSTTTYGITRRSLLSGAAAGAVASVLPASALAATRKIPLTRSE
ERVVVIGSGFGGGISALRLAQAGIPVLVLERGRWWKSGPNAETFPHATIPDKRDLFYSIW
PEKNHKRVGISPYVGLLEPVRGKNITAICPAGVGGGSLVYQGMTVQPSEDVFSQWFPAGV
DYQEMDEVYYRRVTAMLHAQTAPDALINSSQYRAARKFAANVQAAGYSLTKIPMPIDWNY
ALAELRGEMKQSYTNGDCALGVNNGGKFSVDVTYIEQALATGLVRVEAQHNVTSLLRAAN
GHWEIHVSRTNARGTVLEHKIITTPTLILAAGSINTTRLLVSAAARGDITDLPDGLGKGY
GTNGDQIYLWRNPDSALASPQGGPVIYGSYDWSSPTRLANTVIQASIPPGSRFIGNTLTS
SVLLPGAAALSRSAKMHATMLVGFGVSNGRGHFEYNAAKDRTDLIWPANGDAEIAKCIHE
RVLKIAGEGSKVINTNKIVNSTWHSLGGACIDVVCDLEGRVKGQRGLYVLDGALMPGTTC
AANPSMTIAAMVERALDRIVRDDIGTII
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaaaacaagaacaagcccctccacccactaccgaaaccgcagcaccctcaacc
acaacctacggcatcacccgccgcagccttctaagcggtgcggccgcaggggcggttgcc
agcgtgctgcctgcatccgccctcgccgctactcgcaaaatccccctcacccgctccgaa
gaacgcgtcgtggtgattggttccggatttggcggtggcatctcggccctacgcttagca
caagccggcattcccgttctggtgctagaacgtggtcgctggtggaaatccggccccaac
gccgaaaccttcccacacgcgaccatccctgacaaacgcgacctgttctattccatctgg
cccgaaaaaaaccacaaacgcgtgggcatttccccttacgtgggcctgctagaacctgtg
cgcggaaaaaacatcaccgccatttgcccagcaggtgtcggcggcggctcgctagtctat
cagggcatgaccgtacagccctcggaagacgtgttcagccaatggtttccggcaggcgtt
gactatcaagaaatggacgaggtctattaccgccgcgtgactgcgatgctacacgcacaa
accgcaccagatgcactgattaacagcagccagtaccgcgcggcccgcaaatttgcagca
aacgtgcaagctgccggctactcactcaccaaaatccccatgcccatcgactggaactac
gcacttgcagaattacgcggcgaaatgaaacagtcttacaccaacggcgactgcgccttg
ggcgtaaacaacggcggcaaattctcggtagacgtcacttacatcgaacaggcgctcgcc
acagggctagtgcgcgttgaagcacaacataacgtcacttcgctgctacgcgccgccaat
ggccactgggaaattcacgtcagccgcaccaacgcgcgcggcaccgtgttagagcacaaa
atcatcaccacccccacgctaatcctcgcggcaggtagcattaacactacacgcctcttg
gtaagcgccgccgcacgcggcgacatcacggatctaccagacggcttgggtaaaggctac
ggcaccaatggcgaccagatctacctttggcgtaaccccgacagcgcactggcctctcca
caaggcgggccggtgatctacggcagctacgactggtcaagccctacacgcctcgcgaac
accgtaattcaagcgtcgatcccgcccggcagccggtttatcggcaacaccctgaccagt
tccgtgctgctacctggagccgccgctctctcccgctctgccaagatgcacgctaccatg
ctggtaggttttggggtgagcaatggccgcggccactttgaatacaacgccgcaaaggac
cgcaccgacctgatctggcccgccaatggcgacgccgagatcgccaaatgcattcacgag
cgcgttctcaagatcgctggggaaggcagcaaggtgatcaacaccaacaaaattgtcaac
tctacctggcactcgctcggcggcgcctgcatcgacgttgtttgcgatcttgaagggcgg
gtaaaagggcagcgcgggctttatgtgctagacggcgcgctaatgcccggcaccacctgc
gccgcgaacccgtcaatgacgattgcggcgatggttgagcgcgccttggatcgtatcgtc
agggacgatatcggcacgatcatttag

DBGET integrated database retrieval system