KEGG   Gamma proteobacterium HdN1: HDN1F_26370Help
Entry
HDN1F_26370       CDS       T01300                                 

Gene name
chII
Definition
Magnesium chelatase, subunit ChII
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gpb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3243723..3244991
Genome map
AA seq 422 aa AA seqDB search
MSENGRYEIFPFSAIAGQEELKLALLLAAIEPQVGGVLVEGPRGTAKTTAARALASLMAP
APFVSLPLGCSLEHLVGSLDLAEALGRQTLRLAPGLLAKAHEGVLYVDEINLLPDALVDV
LLDAAASGTHRIERDGLSHQHPARFVLIGTMNPQEGRLRPQLLDRLGLSVEVSNLSDPTQ
RSQVVRARLAFDRNPQAFHAAWEPSQKALAQRLAYARRLVAAIQDEQIPEIVWETIARYC
VENAVDGLRADIVMLRAAKAFAAWRTASACGSEESAKESAESAVVGPEDVNAVSEFVLRH
RRQSPTALQPLTNQPPSENQRKPAKQSPPSPRPAREPASQVSATPPQAPPGDRIPENEPS
TEARTATENTSANYSTNNDWGEMVPQPVAAAARSNPQLQNWLTTLSHAFAEEAPTKKAPP
PK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaatggccgttatgaaatatttcccttttccgccattgccggacaggaggag
ttaaagctcgcgctactgctggcagcgatcgagccacaagtaggcggtgtactcgtcgaa
ggcccacgcggcaccgcgaaaaccaccgccgcccgcgcattggcatcgttaatggcgccg
gcaccgtttgtgagcttgccgcttggatgctcattggagcacctcgtaggcagccttgat
cttgccgaagccttaggcagacagacgctgaggctggcccccggcctgttggccaaggct
cacgaaggcgttctttatgtagatgaaatcaatctgctgcccgatgcgctggtcgatgtg
ctactggatgcggccgcaagcggaacccatcgcatcgagcgcgatggtctgtcgcaccaa
catccagcacgcttcgtgctgatcggcaccatgaacccacaagaaggccgcctgcgccca
cagctattggatcggctgggcttgagtgtagaagtatccaatctttccgatcccacccag
cgttcacaggtggttcgcgctcgacttgcctttgatcgaaacccacaggcgtttcatgcc
gcttgggagccgtcccaaaaggcgttggcacagcgccttgcttatgcgcgcagattggtt
gcggcgattcaggatgagcaaatccccgaaatcgtttgggaaaccattgcccgttattgc
gttgaaaacgccgtagacggcctgcgtgccgatatcgtaatgctgcgcgccgccaaagcc
tttgccgcttggagaacggcatccgcttgcggctctgaagaaagcgctaaagaaagcgcc
gaaagtgcagtcgttgggccagaggatgtaaacgcagtttctgaattcgtactgcgccat
cgccgccagtcacccaccgcgttacagcctcttaccaatcaaccgccatccgaaaatcag
cgcaagcccgcaaaacagtcgccgccttcaccaaggcccgcgcgcgagcccgcatcgcag
gtgagcgctactccaccgcaagcgccgcccggcgaccgtatcccggaaaacgagccatcc
accgaagcccgcaccgctacagagaatacttctgcgaattacagtacgaataacgattgg
ggtgagatggttccacagcccgttgccgctgctgcacgctccaacccgcaactgcaaaac
tggcttactacactttcacacgcatttgccgaggaagcgcccacaaaaaaagcgccaccc
ccgaagtaa

DBGET integrated database retrieval system