KEGG   Gamma proteobacterium HdN1: HDN1F_27080Help
Entry
HDN1F_27080       CDS       T01300                                 

Gene name
aphF
Definition
acetaldehyde dehydrogenase
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HDN1F_27080 (aphF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDN1F_27080 (aphF)
   00650 Butanoate metabolism
    HDN1F_27080 (aphF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HDN1F_27080 (aphF)
   00622 Xylene degradation
    HDN1F_27080 (aphF)
   00621 Dioxin degradation
    HDN1F_27080 (aphF)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HDN1F_27080 (aphF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     HDN1F_27080 (aphF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3343668..3344576)
Genome map
AA seq 302 aa AA seqDB search
MATAPTKKLRAAIIGPGNIGTDLLMKAMRSPLIEPVWMVGIEESEGIKRARDFGMKVSTQ
GVDGLVPHMKEDNIEIVFDATSAYVHAENSRKVNEQGAIMIDLTPAAIGPFCIPPVNLGS
LLKEGRKENVNMVTCGGQATIPMVYAVSRVQEVEYGEIVATVASKSVGPGTRKNIDEFTR
TTAGAIERVGGAKKGKAIIIVNPAEPPLIMRDTVHCLTKDKPDEARITESVHAMLAEVQK
YVPGYRLTNDLVFDEHRVSIFLNVEGLGDFLPKYSGNLDIMTAAALRTAEMYADAIAHGT
LG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccacagctccaacaaaaaaactccgggccgccatcattggccccggcaatatcggc
actgatctattgatgaaagccatgcgcagcccgttgatcgagcctgtctggatggtcggc
attgaagaatccgaaggcatcaaacgcgcccgcgatttcggcatgaaagtctccacccaa
ggcgtagacggccttgtgccgcacatgaaagaagacaacatcgaaatcgttttcgacgcg
acttctgcctacgttcacgccgaaaactcccgcaaagtgaacgagcaaggcgccatcatg
atcgaccttacgcctgccgccatcgggccgttttgcattccgccggtaaaccttggcagc
cttttgaaagaaggccgcaaagagaacgtcaacatggtcacctgcggtggacaagccacc
attccgatggtgtacgcagtcagccgcgtgcaagaagtcgaatacggcgaaatcgttgcc
acggttgcttccaagtctgtaggccccggcacccgtaaaaacatcgacgaatttacccgc
accacggcaggcgcaattgagcgcgttggcggtgccaaaaagggcaaagcgatcatcatc
gttaaccccgccgagccgccactcatcatgcgcgatacggtgcactgcctcaccaaagac
aaacccgatgaagcgcgcatcaccgaatccgttcacgcgatgctagctgaagtgcagaaa
tacgtgccaggttatcgcctcaccaatgacctcgtatttgatgaacaccgcgtatccatt
ttcttgaacgtcgaagggctgggcgactttttgccgaaatactccggcaacctcgacatt
atgaccgctgccgcattgcgcaccgcagaaatgtatgccgatgccattgcccacggcacg
ctcggttaa

DBGET integrated database retrieval system