KEGG   Gamma proteobacterium HdN1: HDN1F_27430Help
Entry
HDN1F_27430       CDS       T01300                                 

Definition
(GenBank) Predicted enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00071  Fatty acid degradation
gpb00280  Valine, leucine and isoleucine degradation
gpb00281  Geraniol degradation
gpb00310  Lysine degradation
gpb00360  Phenylalanine metabolism
gpb00362  Benzoate degradation
gpb00380  Tryptophan metabolism
gpb00410  beta-Alanine metabolism
gpb00627  Aminobenzoate degradation
gpb00640  Propanoate metabolism
gpb00650  Butanoate metabolism
gpb00903  Limonene and pinene degradation
gpb00930  Caprolactam degradation
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01212  Fatty acid metabolism
Module
gpb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HDN1F_27430
   00650 Butanoate metabolism
    HDN1F_27430
  Lipid metabolism
   00071 Fatty acid degradation
    HDN1F_27430
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HDN1F_27430
   00310 Lysine degradation
    HDN1F_27430
   00360 Phenylalanine metabolism
    HDN1F_27430
   00380 Tryptophan metabolism
    HDN1F_27430
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDN1F_27430
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HDN1F_27430
   00281 Geraniol degradation
    HDN1F_27430
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HDN1F_27430
   00627 Aminobenzoate degradation
    HDN1F_27430
   00930 Caprolactam degradation
    HDN1F_27430
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HDN1F_27430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CBL46326
UniProt: E1VND4
Position
3381354..3382133
Genome map
AA seq 259 aa AA seqDB search
MAFETLIENGVAELIFCKPPVNAFNSQEWAAISDKIDDLGADPQVKVIVIRAEGKGFCAG
VDIKELAADSTKIIAVNKGNYDTFKSIHLNPKPVIVAVHGFVLGGGIGISGAADIIVASE
CARFGVPEVDRGAMGGGAHLQRMFPVQKVRYMYYTGDFINAQEAYRLGAVERVVPLDQLR
ATALEIAAKIAEKSSPMIQLAKEALTGIEDGNLEDKYRWEQGFTLQAYTEKDSQEARNAF
VEKRDAAFKNDATNSAKHS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcctttgaaactcttatcgaaaacggcgttgccgaactgattttttgcaaaccgccg
gtaaatgccttcaatagccaagaatgggcggcaatctctgacaaaattgatgacttaggc
gcagacccgcaggtaaaagtcattgtgatccgcgccgaaggaaaaggcttttgcgccggg
gtagacatcaaagagcttgctgccgatagcaccaaaattatcgcggtaaataaaggcaat
tacgacaccttcaaatccattcacctaaatccgaagccggtcatcgtagcagttcacggc
tttgtgctgggtggcggcatcggaatttccggcgcggcggatattatcgtcgcctctgaa
tgcgcacgtttcggtgtcccagaagtcgatcgcggcgcgatgggtggtggtgctcacttg
cagcgtatgttccccgtgcagaaagtccgttatatgtattacaccggcgattttattaac
gcacaagaagcctaccgccttggcgcagtagagcgcgttgttccgctagaccaattgcgt
gcaaccgctttggaaattgccgccaagatcgcagaaaagagctccccaatgattcagctt
gccaaagaagccctcaccggcattgaagatggcaacctagaagataaataccgctgggag
caaggcttcaccctgcaagcctacaccgaaaaagactcccaagaagcccgcaacgccttt
gttgaaaaacgcgacgcagctttcaagaatgatgccactaactctgccaaacactcgtag

DBGET integrated database retrieval system