KEGG   Gamma proteobacterium HdN1: HDN1F_28640Help
Entry
HDN1F_28640       CDS       T01300                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gpb  Gamma proteobacterium HdN1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3521341..3521970
Genome map
AA seq 209 aa AA seqDB search
MTSLRTRRRMVKRLREAGISQPEVLAVMEKTPRHLFVDEAFAHRAYEDTALPIGFNQTIS
QPYIVARMTGLLLQAGPLSDVLEIGTGSGYQTAILAQLVKHVYSLERIKALQDRARQRLH
SLRIRNVSLRHSDGGLGWAEQAPYDGILAAAAPAEIPEDLILQLRPGGRMVIPVGGASQQ
LVLVIRKERGFERQVVEDVNFVPFQSGIA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttgcgcacgcgcagacggatggtcaagcgtttgcgcgaagctggaatcagc
cagcctgaagtgcttgccgtgatggaaaaaacgccgcgccacctgtttgtggatgaggcg
tttgcgcaccgcgcctatgaagatactgcgcttcccatcggtttcaatcaaaccatctcg
cagccctatatcgtggcgcggatgacagggcttctgttgcaggccgggccgctgagtgat
gttttggagatcggtacggggtctggttatcagacggcgattctggcgcagctcgtcaag
catgtctattcgctggagcgaatcaaggctctgcaagatcgggcgcgccagcgtttgcat
tctttgcgtatccgcaatgtgagccttcgccattccgatggcgggttgggctgggcggaa
caggcgccttatgacggaatccttgcggccgctgctcctgcggagattccagaagatttg
attctgcagctacggccaggtgggcggatggtgatcccggtcggcggggctagccagcag
ctcgtgctggtgattcgtaaagagcgcggctttgaacgacaagttgtggaagatgtcaac
tttgtcccctttcagtctgggattgcgtag

DBGET integrated database retrieval system