KEGG   Gamma proteobacterium HdN1: HDN1F_28740Help
Entry
HDN1F_28740       CDS       T01300                                 

Gene name
recD
Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDN1F_28740 (recD)
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HDN1F_28740 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3539358..3541319
Genome map
AA seq 653 aa AA seqDB search
MPSNEMGDLEGAALPRELLSRELLPRELFGWQLDGWLRPVDIGLAQLLVELGHEKDADVL
IASALVSYHLGCGHVCMDLDALLHSPEAFLPNQRGLKHPWRVQIARWQQIGVNALCERLR
ASDVVGEGEGAEPLVLDKNRLYLRRYWHYETLVASGVRDRMSAPRPIQDLKESLARLFPE
ATEIPDWQQVAVAMASAHSFAVISGGPGTGKTTTVVRLLSLLQEQAIAKEGGRPLRIALA
APTGKAAARLTESISGTKSKLSNAALIPDQVSTLHRLLGIRTDGGRPRYYRGKLLHVDVL
VIDEASMVDLEMMAAVMAALPAKAQLILLGDKDQLASVEAGAILGEICKNAHLARYSEAA
CGELLQSAGVALTPVSDAIVLDDHIVTLKKSYRFQGAIGALASAMNESNAPKMFEILNSG
DSAVQFRNTSQLHKTLAELVLDPASGYALYLRTLQQGCPTGQDMNAWAKTLLEQLSTFQI
LCALRKGPAGVDAVNEAVVSMLKSHSLISQNTGWYAGRPVMVTRNDYSTGLMNGDVGIAL
PEPTSENASPESPPVLRVYFAQPDGIRRVLPSRLTQAETVFAMTVHKSQGSEFKHTCLVL
PESSGAGLTRELVYTAVTRAKERVTIVGSDAQVLARAIQQRVVRCSGLAERLA
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccctccaatgaaatgggagatcttgagggtgcggcgctccccagagagttactgtcc
agagagctactccctagagagttatttggttggcaattggatggttggctgcgccctgtg
gatatcgggctcgcccaattgttggtggagcttggccatgagaaagatgcggatgtactt
attgcgtcggctttggtgagttatcacctagggtgtggccatgtttgtatggatttggac
gccttgctccattcaccagaagcctttcttccaaaccagcgtggcttaaagcatccttgg
cgcgtgcagatcgcacgctggcaacagatcggcgtgaatgcgctttgcgagcgtttgcga
gcgagcgatgtagtgggggaaggagagggggcagagcctttggtgctggacaaaaatcgc
ctctacctccgacgttattggcactatgagactctggttgctagcggcgtacgggatcgc
atgagtgccccgcgacccattcaggatttgaaggaaagcctcgcgcgcctttttccagaa
gcgacagaaatacccgattggcaacaggtggcggttgcaatggcgtccgcacactcattt
gcggtgatttccggcggtcccggtactggaaaaaccactaccgttgtgcgcctgctgtca
ctccttcaggagcaggcgattgcgaaagagggcggccgccccctacgaattgcgttagca
gcgcccacaggaaaggccgctgcgcggttaacagaatccatcagtggcacgaaatccaaa
ttatcgaatgccgcgctgattcccgaccaggtgtccaccttgcaccgcctcttgggaatc
cgcaccgacggtggcaggccgcgttattaccgaggaaagctgctgcatgttgatgtgctg
gtcattgatgaagcatccatggtcgatcttgaaatgatggccgcagtaatggccgcgctg
cctgcgaaggcgcagctcatccttttgggcgacaaagaccaattggcctcagtagaagcc
ggggccattcttggcgaaatctgtaaaaacgctcacttggcgcgttacagcgaggcagct
tgcggcgagttgttacagagtgcaggcgtcgcacttacgcctgtaagtgatgccatagtt
ctggatgatcatatcgttacgctaaaaaagagctaccgctttcaaggcgcgatcggcgcg
ctggcaagcgcaatgaatgaatccaatgcgccaaaaatgttcgagattctcaattcggga
gattctgcggttcagttccgaaacacctcgcagctccataaaaccctagcggagctcgtg
ctcgatccggctagcggctatgcgctgtacctgcgaaccttgcaacaagggtgccccaca
gggcaagacatgaacgcatgggcgaaaaccctgctagagcaactgtctactttccagatt
ctatgtgctctccgcaaaggcccagcgggagtggatgccgtaaatgaggcagtggtaagc
atgttaaaatcgcattcgttgatttcccagaatacgggctggtatgcagggcggcctgtg
atggtgactcgtaacgactatagtactgggcttatgaacggtgacgttggcattgctctg
ccggagccgacctctgaaaacgccagcccagagagccctccagttttgcgagtctatttt
gcccagcccgacggcattcggcgtgtgttgcctagtcgtttaacgcaagcggaaaccgtg
tttgcgatgaccgtgcataaatcgcaggggtcagagttcaaacatacctgtttagtgctg
ccagagagcagcggcgccgggctgacgagggagttggtttataccgccgtcacgcgagcg
aaagagcgcgtaaccatcgttggaagtgatgcacaagtgttggcgcgcgcgattcaacaa
cgcgtggtgcgctgttctgggcttgcggagcggcttgcctag

DBGET integrated database retrieval system