KEGG   Gamma proteobacterium HdN1: HDN1F_30400Help
Entry
HDN1F_30400       CDS       T01300                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00071  Fatty acid degradation
gpb00280  Valine, leucine and isoleucine degradation
gpb00281  Geraniol degradation
gpb00310  Lysine degradation
gpb00362  Benzoate degradation
gpb00380  Tryptophan metabolism
gpb00410  beta-Alanine metabolism
gpb00640  Propanoate metabolism
gpb00650  Butanoate metabolism
gpb00903  Limonene and pinene degradation
gpb00930  Caprolactam degradation
gpb01040  Biosynthesis of unsaturated fatty acids
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
gpb01212  Fatty acid metabolism
Module
gpb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HDN1F_30400
   00650 Butanoate metabolism
    HDN1F_30400
  Lipid metabolism
   00071 Fatty acid degradation
    HDN1F_30400
   01040 Biosynthesis of unsaturated fatty acids
    HDN1F_30400
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HDN1F_30400
   00310 Lysine degradation
    HDN1F_30400
   00380 Tryptophan metabolism
    HDN1F_30400
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HDN1F_30400
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    HDN1F_30400
   00281 Geraniol degradation
    HDN1F_30400
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HDN1F_30400
   00930 Caprolactam degradation
    HDN1F_30400
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     HDN1F_30400
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     HDN1F_30400
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     HDN1F_30400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH F420_oxidored AlaDh_PNT_C DUF2680 2-Hacid_dh_C NAD_binding_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: CBL46623
UniProt: E1VP81
Position
3729014..3731158
Genome map
AA seq 714 aa AA seqDB search
MTEAIRYEKDSDNIVVLTMDMPGQSANTMNAAFTEAFDGVLTRLEKEEKLAGVVVASAKK
TFFAGGDLNDLIKVTPENAEQFYQATNVIKGHLRRLEKLKAPVVAAINGAALGGGLEICL
ACNYRIALNDRKIKLGLPEVTLGLLPGAGGIVRMTRMLGLEAALPLLLEGKQLAPDAAKA
AGIINEIADSPEDMLAKAKAWCKANANAQQPWDQKGYKVPGGTPSTPALAQKLPIIPAFL
LNKTKGCYPAPEAILSAAVEGLQVDFDTAIKIEGRYFVSLATGQVSKNMINAFFFNLQEI
NKGASRPKGVPVKPVKKVGILGAGMMGAGIAYVSAMSGIEVVLKDISDENAQKGKDYSVK
LLAKRVSKGQMTQEKADGILAKIKPTGNAADLAGCDLVVEAVFEKRELKASVTKEAEAVM
DANGTFASNTSSLPITGLAEASVRPEKFIGLHFFSPVDKMPLVEIICGKKTSQETLAHAL
DYVLQIKKTPIVVNDARGFFTTRVIGTYVNEGLRLLAEGAAASSIEMAAARAGFPIGTLA
ISDELNFTTMRNIRLQAEKDLAAEGKSLPADDPSKIILDTMIDKLGRTGKLGGAGFYEYP
QAGKKHLWSGLKELFNKADASIPFEDMGDRFLFIQSLEAVRCMEEGVIERVADANIGSIM
GIGFPPWTGGVIQFINGYGLRKFVARAQELAARYGERFNPPALLVEKAEKGETF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcgattcgttacgaaaaagatagcgacaatatcgttgtgctcaccatggat
atgcccggccagtctgccaacaccatgaatgctgcgtttacggaagcgttcgatggcgtg
ctgacgcgtttggaaaaagaagaaaaactcgcaggcgttgtagttgcctctgcgaaaaaa
accttttttgcgggtggtgaccttaacgatctgattaaggtaacgccggagaatgcagag
caattttatcaagccacgaacgtaattaaggggcacctgcgccgcctcgaaaaattgaaa
gcgccggtagttgcagcaatcaatggtgcagcactcggtggcggccttgagatttgcctt
gcctgcaattatcggattgcattaaacgaccggaaaatcaagctcggcttgccagaagtg
acgctaggtctattgcctggcgctggcggtatcgtaagaatgacccgtatgctcggccta
gaagctgctttacctcttctgttggaaggaaagcagttggctccggacgcagcgaaagcg
gcaggcattatcaatgaaatcgccgatagcccagaagacatgctggccaaggcaaaagcg
tggtgcaaggccaatgcgaatgcacagcagccttgggatcagaagggctacaaagttccg
ggtggcacgccatctacgcctgcactcgcgcagaagctgccgattatccccgcgtttttg
ctgaacaaaaccaagggctgctaccctgcacctgaagcaattttaagtgctgcggttgaa
ggcttgcaggtggatttcgatacggcgattaaaattgaagggcgctactttgtgtcgctt
gccacggggcaagtcagcaaaaatatgatcaatgcctttttctttaaccttcaggaaatc
aataaaggcgcaagccgcccgaaaggtgtgcctgtaaagcctgtgaaaaaggttggtatt
ttgggcgcgggcatgatgggtgcggggatcgcttacgtttctgcgatgtcgggtattgag
gttgtgctcaaagatatatccgatgagaatgcgcagaagggcaaggattattcggtgaag
ttgttggcgaagcgtgtttcgaaagggcagatgacccaagaaaaagccgacggtattcta
gcgaagatcaagcctaccggaaatgctgctgatctggcaggttgcgatttagtggtggag
gcggtatttgagaagcgcgagctgaaggcgagcgttaccaaagaagctgaggcggtgatg
gatgccaatggcacctttgcatcgaacacttccagcctccccattaccggccttgcggaa
gcatcggttcgccctgagaagtttatcggcctgcactttttctctcctgtggacaaaatg
ccgctggtggaaattatttgcggcaagaaaacttcgcaagaaaccttggcgcacgcgctg
gattatgtgctgcaaatcaagaaaacaccgatcgtggtcaatgatgcgcgcgggttcttt
acgacgcgcgtaatcggtacctatgtcaacgagggcttgcgtttgttggcggaaggtgct
gctgcatcgtccattgaaatggctgctgcgcgcgcgggctttccaattgggacgcttgcg
attagcgatgagctgaatttcaccacgatgcggaatatccgcctgcaagccgaaaaagat
ttggctgcggaaggaaaatcgctgccggccgatgatccttctaagatcattcttgacacc
atgattgacaagctcggccgtacaggaaagctaggtggggcaggtttctatgaatatccg
caagcgggcaagaaacatctctggtcgggcctgaaggagctgttcaataaggcagatgcg
agcattccttttgaggatatgggagatcggttcctgtttattcagtcattggaagcagtg
cgctgcatggaagaaggtgtaattgagcgcgttgctgatgccaatattggttcgattatg
gggattggtttcccgccgtggactggtggcgttatccagtttattaacggatatgggttg
cgtaagtttgtagcgcgtgcccaagagttggcggcgcgttacggtgagcgctttaatccg
ccggcgctgttggtggagaaagcggagaagggagagactttttag

DBGET integrated database retrieval system