KEGG   Gamma proteobacterium HdN1: HDN1F_32240Help
Entry
HDN1F_32240       CDS       T01300                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HDN1F_32240
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HDN1F_32240
Exosome [BR:gpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HDN1F_32240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3937161..3938648
Genome map
AA seq 495 aa AA seqDB search
MPTYLLAIDQGTTSSRAIVFDRRGAIIAQSQQEFSQHFPADGWVEHDPEEIWQSVLTVVR
GVLEKAHLSAQEIAGIGITNQRETTIVWDRATGEALYPAIVWQDRRTTEGCLRLRAQGHE
AMVQERTGLLLDPYFSATKAAWVLDHVAGARERAERGELAFGTIDTFLLWRLTGGREHRT
DATNASRTLLFNIHTQDWDADLLSLFGVPRAMLPEVMDCSAEFGETQAALFGAPIPVAGM
AGDQQAALIGQACFERGMIKSTYGTGCFMILNTGERALQSSHRLLSTVAYRLDGRVTYGL
EGSIFVAGAAIQWLRDGLALINNAQECEALAREAGVDHHVYMVPAFTGLGAPYWDPEARG
ALFGLTRDTGIKDIVTAGLQSVAYQTRDLIQAMRSDGAGELTTLRVDGGMVANNWVVQFL
ADLLNVNVDRPAVIETTALGAAYLAGLQRGVYASLEEIANLWHCQQHFEPQMEDGLRERL
YAGWVDAVRRVRKNL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcccacctatctgcttgccattgaccaaggtaccactagctctcgcgcgattgttttt
gatcggcgcggtgcgatcatcgcgcaatcgcagcaggaattttcgcagcattttccggcg
gatggatgggtggagcacgatcctgaagaaatttggcagagtgtgctgacggtggtgcgt
ggggtgctggaaaaggcgcatttatcggcgcaagaaattgccggcatagggattacgaac
cagcgcgagaccaccattgtttgggatcgtgcgaccggcgaagcattgtatccggcaatt
gtctggcaggatcgacgcactacggaaggctgcctgaggttgcgcgcgcaggggcacgaa
gcaatggtgcaggagcgcacggggcttttgctggacccgtatttttcggccaccaaagcc
gcgtgggtgttggatcatgtcgccggtgcgcgcgaacgtgcagaacgcggtgagttggct
tttgggacgatcgacacttttttgctgtggcgtttgaccggcgggcgcgagcaccgaacg
gatgccaccaatgcttctcgcactctgctgtttaatatccacacgcaagactgggatgcg
gatttgctttcgctgtttggcgttccgcgcgcgatgttgccggaggtgatggattgcagc
gcggagtttggcgaaacgcaagcggcgctctttggcgcaccgattcctgtagcgggcatg
gcgggcgatcagcaggcggcgctaatcggccaagcttgctttgagcgcggtatgatcaaa
agcacctatggaacaggctgctttatgattttgaataccggagagcgtgcgcttcagtcg
agccaccgcttgctttctacggtcgcttaccgcttggatgggcgcgtaacgtacgggctg
gagggcagcatttttgtcgctggggcggcgattcaatggctgcgagatgggcttgcgctg
atcaataatgcgcaggaatgcgaggcgctggcgcgtgaggcgggtgtcgatcatcatgtg
tatatggtgccggcgtttactggtttgggtgcgccttattgggatccagaggcgcgcggt
gctttgtttgggctgacgcgtgataccggtatcaaggatatcgtaacggcggggttgcag
tccgttgcttatcagacccgtgatttgattcaggcgatgcgctcggatggtgcgggcgag
ctgaccactctgcgagtggatggcggcatggtggcgaacaattgggtggtgcagtttttg
gcggatcttctcaatgtgaatgtggatcggcctgcggttattgaaacgacagccctaggt
gccgcttatctggctggcttgcagcgcggtgtatatgcttcgttagaagaaattgcgaat
ttgtggcactgccagcagcattttgaaccgcaaatggaggatgggctgcgtgagcggctt
tacgcggggtgggtggatgccgttcggcgggtgcggaagaatctgtag

DBGET integrated database retrieval system