KEGG   Gamma proteobacterium HdN1: HDN1F_32590Help
Entry
HDN1F_32590       CDS       T01300                                 

Definition
carbohydrate kinase PfkB
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDN1F_32590
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HDN1F_32590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3978590..3979600
Genome map
AA seq 336 aa AA seqDB search
MKFDVVTVGSAAVDYFADTDSELIRIDTKTRKIELIAFPLGSKLLIRELLVLTGGGGTNT
AVSFARLGFSTGYLGKLGDDGNGEFIIDSLAKEGISFIGAREGQTGMSIILDSINDDRSI
LAFKGANDQLHPSDVPEFESQWIYMSSMLGQSFDTVTDLVASGRYKVAFNPSNYQTVRGY
DGLKQVIDHCTILIMNREEACEFLGFTYSKSPSIAVLMAEMEKLPPKIFGITDGAGGVYI
FDRTHLYHGKPSPDLVIAETTGAGDAFSSTFTAMIMKGLSVKDAIHYAMTNSESVISHKG
AKEILLTWEQLQKAASSTPRSIDVGDLQTPPPEASN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgatgtggtaaccgtgggcagtgctgcagtggattattttgcggacaccgat
tctgagttgattcgcattgataccaagacacgcaagattgagttaattgcgtttccgctg
ggaagcaagctgttgattcgtgaactgctggtgttaaccggtggggggggaactaacact
gccgtctctttcgcacgcctcggtttttctacaggctatcttgggaaattaggcgatgac
ggtaatggtgagtttatcattgacagtctcgcaaaagagggaatttcgtttattggtgct
cgtgaagggcaaacagggatgtccattattcttgatagcatcaacgatgatcgcagcatt
cttgcgttcaaaggggcaaacgaccagcttcatccgtccgatgtgccagagtttgagtca
cagtggatttatatgtcgagtatgttggggcagagttttgacaccgttacagatcttgtc
gcaagcggtcgttacaaggttgcgttcaacccttccaattatcagactgtgcgtggctac
gatggcctcaaacaggtcattgatcattgcaccatcttgatcatgaaccgtgaagaggct
tgcgaatttctcggttttacctattcaaaaagcccctctattgcggttctgatggcagaa
atggagaaactaccgcccaaaatttttggcattacggatggtgcaggcggcgtttatatt
tttgaccggacgcatttgtaccatggtaaaccttcgcccgatctcgtcattgcggaaacc
acgggtgcaggggatgcgttttcctctacgtttacggcgatgatcatgaagggcttgtct
gttaaggatgcaatccactacgccatgacgaattcagagtcggtgatttctcataaaggt
gcaaaagagatattgctgacgtgggagcaattgcagaaagcagcgtcgtctacgccacgg
agtattgacgttggagatctgcaaacgccgcctcctgaagcgtcaaactag

DBGET integrated database retrieval system