KEGG   Gamma proteobacterium HdN1: HDN1F_33580Help
Entry
HDN1F_33580       CDS       T01300                                 

Gene name
recR
Definition
(RefSeq) Recombinational DNA repair protein (RecF pathway)
  KO
K06187  
recombination protein RecR
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDN1F_33580 (recR)
DNA repair and recombination proteins [BR:gpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HDN1F_33580 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4080983..4081579
Genome map
AA seq 198 aa AA seqDB search
MRLSPAIARLVDALRQLPGVGPKSAQRMALFLLERNRRAAANLADALQNALATVRRCRQC
RLLCENELCEICAHSERDHSLLCVVESPADVFAIEQSGAFRGVYFVLSGRLSPLDGIGPE
QLGLVDLQARLANGGINELILATSATLEGEATAFYLSEMANEAGITATRIAQGVPIGGEL
EQVDSHTLSLALAGRKRL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgagccctgccattgcgcgccttgtggatgcgctacgccaactgccgggcgtt
ggcccgaaatcggcccagcgaatggcgctgttcttgctggaacgtaatcgtagagccgct
gcaaaccttgccgatgccttgcagaatgcgcttgcaacggtgaggcgctgccgccagtgc
cgtttactgtgcgagaacgagttgtgtgaaatttgcgcgcattcagagagggatcattcg
cttctatgcgtggttgaatcgcctgcggatgtctttgcgattgagcaatcgggcgcgttt
cgaggtgtgtacttcgtgctttcggggcgactctcgccgctggatgggattgggcctgag
cagctaggtttggtggatttacaggcgcgtttggcgaatggcgggatcaatgagttgatt
ttagccaccagcgcgacgcttgaaggcgaagcgacggccttttatctctccgaaatggcg
aacgaagcaggcatcactgcaacgcgtattgcgcagggagtgccgattggcggtgagctt
gagcaggtggatagccacacgctaagccttgcgcttgctgggcgcaaacgcctgtag

DBGET integrated database retrieval system