KEGG   Gamma proteobacterium HdN1: HDN1F_33580Help
Entry
HDN1F_33580       CDS       T01300                                 

Gene name
recR
Definition
Recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HDN1F_33580 (recR)
DNA repair and recombination proteins [BR:gpb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HDN1F_33580 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4080983..4081579
Genome map
AA seq 198 aa AA seqDB search
MRLSPAIARLVDALRQLPGVGPKSAQRMALFLLERNRRAAANLADALQNALATVRRCRQC
RLLCENELCEICAHSERDHSLLCVVESPADVFAIEQSGAFRGVYFVLSGRLSPLDGIGPE
QLGLVDLQARLANGGINELILATSATLEGEATAFYLSEMANEAGITATRIAQGVPIGGEL
EQVDSHTLSLALAGRKRL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgagccctgccattgcgcgccttgtggatgcgctacgccaactgccgggcgtt
ggcccgaaatcggcccagcgaatggcgctgttcttgctggaacgtaatcgtagagccgct
gcaaaccttgccgatgccttgcagaatgcgcttgcaacggtgaggcgctgccgccagtgc
cgtttactgtgcgagaacgagttgtgtgaaatttgcgcgcattcagagagggatcattcg
cttctatgcgtggttgaatcgcctgcggatgtctttgcgattgagcaatcgggcgcgttt
cgaggtgtgtacttcgtgctttcggggcgactctcgccgctggatgggattgggcctgag
cagctaggtttggtggatttacaggcgcgtttggcgaatggcgggatcaatgagttgatt
ttagccaccagcgcgacgcttgaaggcgaagcgacggccttttatctctccgaaatggcg
aacgaagcaggcatcactgcaacgcgtattgcgcagggagtgccgattggcggtgagctt
gagcaggtggatagccacacgctaagccttgcgcttgctgggcgcaaacgcctgtag

DBGET integrated database retrieval system