KEGG   Gamma proteobacterium HdN1: HDN1F_34200Help
Entry
HDN1F_34200       CDS       T01300                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00630  Glyoxylate and dicarboxylate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01200  Carbon metabolism
Module
gpb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HDN1F_34200
Enzymes [BR:gpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HDN1F_34200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: CBL47003
UniProt: E1VQB1
Position
complement(4154286..4155881)
Genome map
AA seq 531 aa AA seqDB search
MSNFSQIADQAATEISAFGPSWASINPENVARMRLQNRFRTGLDIAKYTAKIMRADMAAY
DKDSSQYTQSLGCWHGFVGQQKMIAVKKHHGTTKRRYLYLSGWMVAALRSEFGPLPDQSM
HEKTVVANLIEELYTFLRQADARELGGLFRELDAARSAGDKAKEAEILNKVENFETHVVP
IIADIDAGFGNAEATYLLAKRMIEAGACAIQIENQVSDEKQCGHQDGKVTVPHEDFLAKI
RAVRYAFMEMGVEDGIIVARTDSLGAGLTKQIAFTRKPGDLGDQYNSFLDCEEVTPESMK
NGDVIINRNGKLLRPKRLPSNLFQFRKGSGEDRCVLDCITSLQNGADLLWIETEKPHVSQ
IKGMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVYDAWQQAGKDVSAFDRAKLMSVDYD
STELAAEADRRIQSFQKDAAAQAGIFHHLITLPTYHTTALSTDNLAKGYFGEEGMLAYVY
NVQRKEIRQGIACVKHQNMAGSDIGDDHKEYFAGESALLAGGKDNTMNQFS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttttcccaaattgcagatcaagcagccactgaaatttcggctttcggccca
agctgggcttcaatcaatcccgaaaacgtggcacgcatgcgcctgcaaaaccgtttcaga
accggactggatatcgcaaaatacactgcgaaaatcatgcgggctgacatggctgcctac
gacaaagactcctcccaatacacccaatctctgggttgctggcacggctttgttggtcag
cagaaaatgattgctgtcaaaaaacaccatggcaccaccaagcgccgttacctctacctc
tccggctggatggtggctgcacttcgttccgagttcgggccgctgcctgaccaatccatg
cacgagaaaaccgtcgttgccaacctgatcgaagaactctacaccttccttcgccaggca
gatgcacgtgaactcggcggcctgttccgtgagctggacgctgcccgcagcgctggcgac
aaagccaaagaagccgaaatcctcaacaaagttgagaacttcgaaacccacgttgtgccc
atcattgcagacatcgacgctggtttcggcaacgcagaagcgacgtacctgctggccaag
cgcatgatcgaagccggtgcatgtgccatccagatcgaaaaccaagtttccgacgagaag
caatgcggccaccaagacggcaaagtaaccgttccccatgaagacttcctcgcgaagatc
cgcgcagttcgctacgcgttcatggaaatgggcgttgaagacggcatcatcgttgcccgt
accgactctttgggcgctggcctgaccaagcaaatcgcctttacgcgtaagcctggcgac
ttgggcgaccagtacaacagcttcctcgactgcgaagaagtcactcctgagagcatgaag
aatggcgacgtgatcatcaaccgcaacggcaagctgctgcgtccgaagcgtctgccttcc
aacctgttccagttccgtaagggttcaggcgaagaccgctgcgtgctcgactgcatcacc
tcactgcagaacggtgcagacctgctgtggatcgaaaccgagaagccgcacgtttcccag
atcaaaggcatggtggatcgtatccgtgaagtaattccgaatgccaagctggtttacaac
aacagcccatccttcaactggacgctgaacttccgtcagcaggtgtacgatgcatggcaa
caagctggcaaagacgtgtctgccttcgaccgcgctaagctgatgagcgttgactacgac
agcacggaactggccgctgaagctgaccgccgcatccagtccttccagaaggacgctgct
gcacaagccggcatcttccaccacctgatcacgctgccgacgtaccacaccactgcactc
tccaccgacaaccttgcaaaaggctacttcggcgaagaaggcatgctggcctacgtttac
aacgtacagcgcaaagagatccgccaaggcatcgcttgcgtgaagcaccaaaacatggcc
ggctccgacatcggtgacgaccacaaagaatactttgccggcgaatctgcactgttggca
ggcggcaaagacaacacgatgaaccagttctcttaa

DBGET integrated database retrieval system