KEGG   Gamma proteobacterium HdN1: HDN1F_34380Help
Entry
HDN1F_34380       CDS       T01300                                 

Gene name
glcB
Definition
(RefSeq) Malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDN1F_34380 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDN1F_34380 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    HDN1F_34380 (glcB)
Enzymes [BR:gpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HDN1F_34380 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4172286..4174457)
Genome map
AA seq 723 aa AA seqDB search
MTERIRKGGLQIATVLHQLVANEIAPGTGIEPDAFWAAAEKVISTLAPKNKALLAKRAEI
QRKINEWHKARAGQVHDASAYKAFLTEIGYIVPEGPAFAIETPEVDPEISTIAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDVISEEGGAEKGKGYNPVRGAKVVAYAAKVLDEAA
PLANGSHKDATRYLVRDGALTVSLANGSETVLARPEQFVGYQGESVLSAVLLKNNHLHLE
IQIDPSNLIGKDHAAGVKDVLVESAITTIQDCEDSVAAVDAEDKVLAYRNWLGLMKGSLS
ENFEKGGKSLTRRLNPDRHYHAAKGGKLTLPGRSLLLVRNVGHLMTNEAILDANGNEVPE
GIMDALITVFIALHDLQGKGELRNSRKAGIYIVKPKMHGPEEVAFACELFDAVEDVFSLP
RNTIKIGIMDEERRTTVNLKECIRAAKARLMFINTGFLDRTGDEIHTSMEAGPVVPKETM
RSQAWISAYENWNVDIGLRCGLKGKAQIGKGMWAKPDEMKQMVEAKIGHPKAGANTAWVP
SPTAATLHALHYHQINVAERQDEIAKRELAKLDDIITLPLATQKPTAEEVQQELDNNAQG
ILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLHHGFCTEDQVTETMKR
MAAVVDKQNAGDPAYRNMAPDFDDNIAFKAACALVFQGRAQPSGYTEPVLHSRRREAKAK
YGQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcatcaggaagggtggattgcagatcgccaccgtacttcatcagctcgtc
gccaatgaaattgcaccgggaaccggtatcgaacctgacgcgttctgggcagccgctgaa
aaagtcatcagcacacttgcgcccaagaacaaagcgctgctcgcaaaacgcgccgaaatc
cagcgcaaaatcaacgaatggcacaaagcccgcgctggccaagtccatgacgccagcgcc
tacaaagcatttttgacggaaatcggctacatcgtccctgaaggccctgcctttgccatc
gaaacgcccgaagtagacccagaaatctccacaatcgccggcccgcagctggtcgtgccc
gtcatgaatgcgcgctacgcgctgaacgcggccaacgcacgctggggcagtctgtatgac
gccctctacggcaccgacgtgatctctgaagaaggcggcgccgagaaaggcaaaggctac
aaccccgtacgcggcgcaaaagtcgtggcctacgcagcaaaagtgctcgacgaagccgct
ccgctcgccaatggaagccacaaagacgccacccgctacctcgtgcgcgacggcgccctt
accgtcagccttgccaatggcagcgaaaccgtgctcgctcgcccagaacagtttgtcggc
taccaaggcgagagcgtgttgagcgctgtattgctcaaaaacaaccacctgcacctagaa
atccagattgacccaagcaacctgatcggcaaagatcacgcggctggcgtgaaagacgta
ctggtcgaatccgccatcaccaccatccaagactgcgaggactctgtcgcggcagtagac
gccgaagacaaagtactggcctaccgcaactggctgggcctgatgaaaggcagcctgtcc
gaaaacttcgaaaaaggcggcaaatcccttacccgccgtctgaaccccgaccgccactac
cacgcggccaagggtggtaagctcaccctgccgggccgttcactgttgctggtgcggaac
gtaggccacttaatgaccaacgaagccatcctcgacgccaacggcaacgaagtgcccgaa
ggcatcatggacgcgctgatcaccgtctttatcgccctgcacgacctgcaaggcaaaggc
gagctgcgcaatagccgcaaagccggtatttacatcgtcaaacccaaaatgcacggcccc
gaagaagtcgccttcgcttgcgaactgttcgacgccgtcgaagatgtattctcactgccg
cgcaacaccatcaaaatcggcatcatggatgaagaacgccgcaccacggtgaacctgaaa
gagtgcatccgcgccgccaaagcacgcctgatgttcatcaacaccggcttcttggatcgc
accggcgacgaaatccacaccagcatggaagccggcccagtcgtacccaaagaaaccatg
agatcacaagcgtggatctcggcttatgaaaactggaacgtcgacatcggcctgcgctgc
ggtctgaaaggcaaagctcaaatcggcaaaggcatgtgggccaagcctgatgagatgaag
caaatggtcgaagccaagatcggccatccaaaagccggtgcaaacaccgcatgggttccg
tcaccaacggcggccaccctgcacgcgctgcactatcaccagatcaatgttgccgagcgc
caagacgaaatcgccaagcgtgagctggcaaagctcgacgacatcatcaccctaccgctt
gccacccagaagcccaccgcagaggaagttcaacaagaactggacaacaacgcgcaaggc
atcttgggctatgtggttcgctggattgaccaaggtgtaggctgctcaaaagtacccgac
atcaacaacgtcggcctgatggaagaccgcgcaaccctacggatttccagccagcacatc
gccaactggctgcaccacggcttctgcaccgaagatcaggtgacagaaacgatgaagcga
atggcagcggttgtcgacaagcaaaacgccggtgatcctgcctaccgcaacatggctccg
gattttgacgacaatatcgccttcaaagcggcctgtgcgctggtattccaagggcgggcg
cagccgagtggttacaccgagcctgtgctgcactcgcgccgccgtgaggctaaggcgaaa
tacggtcaataa

DBGET integrated database retrieval system