KEGG   Gamma proteobacterium HdN1: HDN1F_34380Help
Entry
HDN1F_34380       CDS       T01300                                 

Gene name
glcB
Definition
Malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:gpb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gpb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:gpb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4172286..4174457)
Genome map
AA seq 723 aa AA seqDB search
MTERIRKGGLQIATVLHQLVANEIAPGTGIEPDAFWAAAEKVISTLAPKNKALLAKRAEI
QRKINEWHKARAGQVHDASAYKAFLTEIGYIVPEGPAFAIETPEVDPEISTIAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDVISEEGGAEKGKGYNPVRGAKVVAYAAKVLDEAA
PLANGSHKDATRYLVRDGALTVSLANGSETVLARPEQFVGYQGESVLSAVLLKNNHLHLE
IQIDPSNLIGKDHAAGVKDVLVESAITTIQDCEDSVAAVDAEDKVLAYRNWLGLMKGSLS
ENFEKGGKSLTRRLNPDRHYHAAKGGKLTLPGRSLLLVRNVGHLMTNEAILDANGNEVPE
GIMDALITVFIALHDLQGKGELRNSRKAGIYIVKPKMHGPEEVAFACELFDAVEDVFSLP
RNTIKIGIMDEERRTTVNLKECIRAAKARLMFINTGFLDRTGDEIHTSMEAGPVVPKETM
RSQAWISAYENWNVDIGLRCGLKGKAQIGKGMWAKPDEMKQMVEAKIGHPKAGANTAWVP
SPTAATLHALHYHQINVAERQDEIAKRELAKLDDIITLPLATQKPTAEEVQQELDNNAQG
ILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLHHGFCTEDQVTETMKR
MAAVVDKQNAGDPAYRNMAPDFDDNIAFKAACALVFQGRAQPSGYTEPVLHSRRREAKAK
YGQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcatcaggaagggtggattgcagatcgccaccgtacttcatcagctcgtc
gccaatgaaattgcaccgggaaccggtatcgaacctgacgcgttctgggcagccgctgaa
aaagtcatcagcacacttgcgcccaagaacaaagcgctgctcgcaaaacgcgccgaaatc
cagcgcaaaatcaacgaatggcacaaagcccgcgctggccaagtccatgacgccagcgcc
tacaaagcatttttgacggaaatcggctacatcgtccctgaaggccctgcctttgccatc
gaaacgcccgaagtagacccagaaatctccacaatcgccggcccgcagctggtcgtgccc
gtcatgaatgcgcgctacgcgctgaacgcggccaacgcacgctggggcagtctgtatgac
gccctctacggcaccgacgtgatctctgaagaaggcggcgccgagaaaggcaaaggctac
aaccccgtacgcggcgcaaaagtcgtggcctacgcagcaaaagtgctcgacgaagccgct
ccgctcgccaatggaagccacaaagacgccacccgctacctcgtgcgcgacggcgccctt
accgtcagccttgccaatggcagcgaaaccgtgctcgctcgcccagaacagtttgtcggc
taccaaggcgagagcgtgttgagcgctgtattgctcaaaaacaaccacctgcacctagaa
atccagattgacccaagcaacctgatcggcaaagatcacgcggctggcgtgaaagacgta
ctggtcgaatccgccatcaccaccatccaagactgcgaggactctgtcgcggcagtagac
gccgaagacaaagtactggcctaccgcaactggctgggcctgatgaaaggcagcctgtcc
gaaaacttcgaaaaaggcggcaaatcccttacccgccgtctgaaccccgaccgccactac
cacgcggccaagggtggtaagctcaccctgccgggccgttcactgttgctggtgcggaac
gtaggccacttaatgaccaacgaagccatcctcgacgccaacggcaacgaagtgcccgaa
ggcatcatggacgcgctgatcaccgtctttatcgccctgcacgacctgcaaggcaaaggc
gagctgcgcaatagccgcaaagccggtatttacatcgtcaaacccaaaatgcacggcccc
gaagaagtcgccttcgcttgcgaactgttcgacgccgtcgaagatgtattctcactgccg
cgcaacaccatcaaaatcggcatcatggatgaagaacgccgcaccacggtgaacctgaaa
gagtgcatccgcgccgccaaagcacgcctgatgttcatcaacaccggcttcttggatcgc
accggcgacgaaatccacaccagcatggaagccggcccagtcgtacccaaagaaaccatg
agatcacaagcgtggatctcggcttatgaaaactggaacgtcgacatcggcctgcgctgc
ggtctgaaaggcaaagctcaaatcggcaaaggcatgtgggccaagcctgatgagatgaag
caaatggtcgaagccaagatcggccatccaaaagccggtgcaaacaccgcatgggttccg
tcaccaacggcggccaccctgcacgcgctgcactatcaccagatcaatgttgccgagcgc
caagacgaaatcgccaagcgtgagctggcaaagctcgacgacatcatcaccctaccgctt
gccacccagaagcccaccgcagaggaagttcaacaagaactggacaacaacgcgcaaggc
atcttgggctatgtggttcgctggattgaccaaggtgtaggctgctcaaaagtacccgac
atcaacaacgtcggcctgatggaagaccgcgcaaccctacggatttccagccagcacatc
gccaactggctgcaccacggcttctgcaccgaagatcaggtgacagaaacgatgaagcga
atggcagcggttgtcgacaagcaaaacgccggtgatcctgcctaccgcaacatggctccg
gattttgacgacaatatcgccttcaaagcggcctgtgcgctggtattccaagggcgggcg
cagccgagtggttacaccgagcctgtgctgcactcgcgccgccgtgaggctaaggcgaaa
tacggtcaataa

DBGET integrated database retrieval system