KEGG   Gamma proteobacterium HdN1: HDN1F_34660Help
Entry
HDN1F_34660       CDS       T01300                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00040  Pentose and glucuronate interconversions
gpb00052  Galactose metabolism
gpb00500  Starch and sucrose metabolism
gpb00520  Amino sugar and nucleotide sugar metabolism
gpb01100  Metabolic pathways
gpb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDN1F_34660 (galU)
   00052 Galactose metabolism
    HDN1F_34660 (galU)
   00500 Starch and sucrose metabolism
    HDN1F_34660 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HDN1F_34660 (galU)
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HDN1F_34660 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CBL47049
UniProt: E1VQF7
Position
4211095..4211931
Genome map
AA seq 278 aa AA seqDB search
MITKCIFPVAGYGTRFLPATKSQPKEMLPVVNKPLVQYGVEEAMEAGLVDVGFVTGRGKR
TIGDHFDISYELEHQIKGTSKEHHLDGIRNVLDNCNFLFARQREMKGLGHAILTGRGMVG
EHPFGVILADDLCITEEGDGVMAQMVKLYKQFRCSIVAIEEVPEDQVNRYGIVSGELIRD
GLYRVVDMVEKPQPKDAPSNLAIIGRYILTPDIFDILENTPPGANGEIQITDALRKQCQD
GVVLAYKFRGRRFDCGSIDGFVEATNYCYENLYKKGRL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgaagtgtatttttccagtggcaggttatggcacccgctttcttcccgccacc
aagtcccagcctaaagagatgctgccggtagtgaacaagccgcttgtgcagtacggggtg
gaagaggcgatggaagctgggttggttgatgttggcttcgtgactggacgcggcaagcgc
accattggtgatcattttgatattagctacgagctggagcaccaaattaaaggcacctcc
aaggagcaccacttggatggcatccgcaatgtgcttgataactgcaactttttgtttgca
cggcaacgtgagatgaaaggtttggggcatgccattctgaccggcaggggcatggtcggc
gagcacccgttcggcgtaattctcgcagatgacctttgcatcaccgaagaaggcgatggc
gtaatggcgcagatggtcaaactgtacaagcagtttcgctgcagcatcgttgccatcgag
gaagtgccagaagaccaagtaaaccgttacggtatcgtttcgggtgagctaattcgcgat
ggtttgtatcgcgtcgtggacatggtggaaaagccacaacccaaagatgcgccctctaat
ctcgccattattggccgctatatccttacacctgatattttcgatatccttgaaaacacg
cctccgggcgcaaacggcgaaatccagattacggatgcactccgcaagcagtgccaagac
ggcgtagtattagcctataaattccgtggccgtcgttttgactgtggcagcattgatggg
tttgtagaagccacaaattattgctacgagaatttgtataaaaagggccgtttgtag

DBGET integrated database retrieval system