KEGG   Gamma proteobacterium HdN1: HDN1F_34660Help
Entry
HDN1F_34660       CDS       T01300                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HDN1F_34660 (galU)
   00052 Galactose metabolism
    HDN1F_34660 (galU)
   00500 Starch and sucrose metabolism
    HDN1F_34660 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HDN1F_34660 (galU)
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HDN1F_34660 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4211095..4211931
Genome map
AA seq 278 aa AA seqDB search
MITKCIFPVAGYGTRFLPATKSQPKEMLPVVNKPLVQYGVEEAMEAGLVDVGFVTGRGKR
TIGDHFDISYELEHQIKGTSKEHHLDGIRNVLDNCNFLFARQREMKGLGHAILTGRGMVG
EHPFGVILADDLCITEEGDGVMAQMVKLYKQFRCSIVAIEEVPEDQVNRYGIVSGELIRD
GLYRVVDMVEKPQPKDAPSNLAIIGRYILTPDIFDILENTPPGANGEIQITDALRKQCQD
GVVLAYKFRGRRFDCGSIDGFVEATNYCYENLYKKGRL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgaagtgtatttttccagtggcaggttatggcacccgctttcttcccgccacc
aagtcccagcctaaagagatgctgccggtagtgaacaagccgcttgtgcagtacggggtg
gaagaggcgatggaagctgggttggttgatgttggcttcgtgactggacgcggcaagcgc
accattggtgatcattttgatattagctacgagctggagcaccaaattaaaggcacctcc
aaggagcaccacttggatggcatccgcaatgtgcttgataactgcaactttttgtttgca
cggcaacgtgagatgaaaggtttggggcatgccattctgaccggcaggggcatggtcggc
gagcacccgttcggcgtaattctcgcagatgacctttgcatcaccgaagaaggcgatggc
gtaatggcgcagatggtcaaactgtacaagcagtttcgctgcagcatcgttgccatcgag
gaagtgccagaagaccaagtaaaccgttacggtatcgtttcgggtgagctaattcgcgat
ggtttgtatcgcgtcgtggacatggtggaaaagccacaacccaaagatgcgccctctaat
ctcgccattattggccgctatatccttacacctgatattttcgatatccttgaaaacacg
cctccgggcgcaaacggcgaaatccagattacggatgcactccgcaagcagtgccaagac
ggcgtagtattagcctataaattccgtggccgtcgttttgactgtggcagcattgatggg
tttgtagaagccacaaattattgctacgagaatttgtataaaaagggccgtttgtag

DBGET integrated database retrieval system