KEGG   Gamma proteobacterium HdN1: HDN1F_37270Help
Entry
HDN1F_37270       CDS       T01300                                 

Definition
steroid dehydrogenase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
gpb  Gamma proteobacterium HdN1
Brite
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     HDN1F_37270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4498323..4499087)
Genome map
AA seq 254 aa AA seqDB search
MTGNPVFDTLLLGVFAAALITILVLLFVNAPYGRHQKGGWGPGIPVRIGWVLMESPASIL
FLIFYLTGDNRAALPCLILLFMWQLHYVHRAFIYPFQIKVKEGAKTPLLVFVMGSTYCAI
NGYLNGSYITHYAPYLNNDWLTDPRFILGIALFAYGYYLNKQSDSILRNLRKEGETGYKV
PHGGGFRWVTMPNYLGEILTWSGFALASWSLAGVSFVVFTMANLVPRALANHKWYRETFT
DYPSARKAIFPKLL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaacccagtgtttgacaccctgcttttgggggtgtttgctgctgcactgatc
accattttggtgttgttgtttgtgaatgcgccgtatggccgccatcaaaagggcggctgg
gggccggggattccggtgcggattgggtgggtgttaatggaatcgcccgcgtcgattctg
tttttgatcttttacctcacgggcgacaaccgcgccgcgctgccttgcttgatcttgtta
tttatgtggcagttgcactatgtgcatcgcgcgtttatctacccgttccagattaaggta
aaagagggggcgaaaacaccactgctggtgtttgtgatgggctctacctactgcgcaatc
aatggctatctgaacggctcttacattacccactacgcgccctatctcaacaacgattgg
ctgaccgatccgcgctttattctaggaatcgcgctgtttgcttatggttattacctcaat
aagcagtcggacagcattttgcgtaatctgcgtaaagagggtgagacgggctataaggtt
ccgcacgggggtggctttcgctgggtgacgatgcctaactatctgggcgagattcttact
tggagtggctttgcgctggcttcgtggtcgctggcgggggtatcgtttgtggtgtttacc
atggccaacttggtgccgagggcgcttgcgaaccataagtggtatcgcgaaacttttacc
gactatccttctgcgcgtaaggcgattttccctaagctgctctag

DBGET integrated database retrieval system