KEGG   Gamma proteobacterium HdN1: HDN1F_37580Help
Entry
HDN1F_37580       CDS       T01300                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    HDN1F_37580 (nosZ)
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     HDN1F_37580 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4528865..4530829)
Genome map
AA seq 654 aa AA seqDB search
MSHDPTSDQEPVNSSRRQFLNQTVALAGAAGAAGVTLGLAGCKKEEPAAGATAGAAAPVS
ATSAAAAAKEEMLHPHPGELDTYYGLWSGGHTGDMRILGFPSGRELHRIPCFVPDVLVGW
GITNESKEVMGTKADGTLKYTVADTHHVHATYKDGNYDGRYAFINDKINSRVARIRLDYF
ICDKITELPNVQGFHGIFPDKRDAVNPDINYSTRLFAGGEFHQPMPNDGHGLDDVAAYRV
LFSCLDIESMEVRWQALIDGNCDLVATSFDGKLAASNQYNVENGAVFAEMMSAERDACIF
FNIARIEEAVKAGKFTTIGDSKVPVVDGTRASNTDPKTALTAYVSVPKNPHGVNASPDGK
YFICAGKLSPTATVIQLDKVLAWFDGSLPNIDDAIVAEVEIGLGPLHTAFDGRGNAYTTL
FLDSQIVKWNVDAAIRFHGGDNTAKYVVDRLDVHYQPGHINATHSETMKADGQWLAVGCK
FSKDRYLPVGPLHAENEQIVDISGEKMRLVSEHPVRPEPHDFVIMRREIISTRQTYNMDE
FPLAVKSFGDSGITRDGKKVTVRLASQAPTFSMTEFRVKQGDEVTIILTNIDTIEDLTHG
FAIHRYNINFIVNPQETKSVTFVADKPGVYWAYCTHFCHALHLEMRLRMIVEPA
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgacccaacttccgatcaggaacccgtcaacagcagccgtcgccaatttttg
aaccagaccgttgcccttgcaggggcggccggtgccgccggggttacgcttggtttggcc
ggctgtaaaaaagaagagcctgctgcaggtgcgacagcgggtgctgctgcaccggtatct
gctacctctgctgccgctgccgcgaaagaagaaatgctgcacccacatccgggtgagctg
gatacctattacggcctgtggagcggtggccatacgggggatatgcggattctgggcttc
ccttcaggccgtgaactgcaccggattccctgctttgtgccagacgtgctggtgggctgg
gggattaccaatgaatccaaagaagtcatgggcaccaaggctgatggcacgctgaaatat
acggttgcggatacccaccacgttcatgcaacctataaagacggcaactacgatggccgt
tatgcgtttatcaacgataaaatcaactcgcgggttgcgcgcatccgcttggattacttt
atctgtgacaaaatcaccgaactgccgaacgtgcagggttttcacgggatttttcctgac
aagcgcgatgcagtaaatccagacataaattacagcacgcgcctatttgccggtggcgaa
ttccatcagccgatgccgaatgatggccacggtctggatgacgttgctgcttatcgagtg
ttgttcagctgcttagatatcgagtcgatggaagtgcgctggcaggccctgatcgacggt
aactgcgacctcgttgcaacctcgtttgatggcaagcttgctgcctctaaccagtacaac
gttgaaaatggtgcggtttttgccgagatgatgtcggcagaacgtgatgcgtgtattttc
tttaacattgcgcgtatcgaagaagcagtaaaagcgggtaagttcaccactattggcgat
tcaaaagtgccggtggtagacggtactcgcgcatcgaacaccgatcccaaaacggcactt
acggcctacgtttccgtgccgaaaaacccgcacggtgtgaacgcgagtcccgatggaaag
tactttatctgcgcaggcaaactctcgcctaccgctaccgtaattcagctggataaagta
ctcgcgtggttcgatggcagcctgccgaatatcgacgatgccattgttgccgaagttgaa
atcggacttgggcccctacatacggcgttcgatggtcgcggtaacgcctatactacgctg
ttcttggacagccagatcgtgaaatggaacgtagacgctgcgattcgcttccacggtggt
gataacactgcaaaatacgtggtagatcgcctagacgttcactaccagcccggccatatc
aacgcgactcattctgaaaccatgaaggccgacggccagtggctagcggtgggctgcaag
ttctcgaaagaccgctatttgccggtaggcccgctgcatgcggagaacgagcagattgtg
gatatttctggtgagaagatgcgcttggtttcggagcaccctgtgcgccctgagcctcat
gattttgtgattatgcgtcgtgaaatcatcagcactcgtcaaacctacaatatggatgag
ttcccgctggccgtgaagagctttggcgattcgggcattacgcgggatggcaaaaaagtc
accgtgcgtctggcgtcgcaagcgccgacctttagtatgacggaattccgcgtcaagcag
ggcgacgaggtgacgattatcctcaccaacatcgacaccatcgaagacttgacccacggc
tttgcgattcaccgctataacatcaactttattgtgaacccgcaggaaaccaagtcggtt
acgtttgtggcagataagcctggcgtgtactgggcgtactgcactcacttctgccacgca
ttgcaccttgaaatgcgtttgcggatgattgttgaaccggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system