KEGG   Gordonia polyisoprenivorans: GPOL_174p00800Help
Entry
GPOL_174p00800    CDS       T01719                                 

Gene name
glcB
Definition
malate synthase GlcB (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_174p00800 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GPOL_174p00800 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    GPOL_174p00800 (glcB)
Enzymes [BR:gpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     GPOL_174p00800 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p174:complement(73553..75742)
Genome map
AA seq 729 aa AA seqDB search
MSDRITVNGLQVSRVLYDFVNDEALPGTGVDADTFWSGAAEIVADLAPKNKALLAVRDDL
QAKIDTWHRDHQGADFSDATTFGEYKDFLTEIGYLVPVPDDFQISTTGVDREISETAGPQ
LVVPVLNARFALNASNARWGSLYDALYGTDVIPETDGAEKGKSYNKVRGDKVIAYAKDFL
DKAVPLEQCSYTDVTAFTVDNGALSVTLADGSTATLADPSAFAGYRGQASSPSSILLRHN
GLYLDIEIDPNSPIGSTDPAGIKDVVMESAITTIMDFEDSVAAVDADDKVLGYRNWLGLN
KGDLAEEVTKGGKSFTRRLNPNREYTGPDGTGFDLHGRSLLFVRNVGHLMTNPAILDADG
NEVPEGILDALVTSLAAIHGLSTHSGVQNSRTGSIYIVKPKMHGPDEVAFTVELFGRVEQ
VLGLPENTLKVGIMDEERRTTVNLKAAIKAAEKRVVFINTGFLDRTGDEIHTSMEAGAMI
RKGEMKKQKWILAYEDFNVDTGLAAGLQHKAQIGKGMWAMTDLMADMVEQKIGQPKAGAT
TAWVPSPTAATLHAMHYHLVDVFERQDEIAKRDPASVDDILTIPLAPRTDWSDEEKREEL
DNNCQSILGYVVRWIDHGVGCSKVPDIHDIALMEDRATLRISSQLLANWIRHGIVTADDV
VDALKRMAPVVDRQNEGDPDYRPMAPDFDSNIAWQAAKELILEGTTQPSGYTEPILHRRR
REYKAAAQG
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccggatcaccgtcaacggcttgcaggtctctcgagtcctctacgatttcgtc
aacgatgaggcgttgccgggcaccggtgtggacgccgacaccttctggtccggagccgcc
gagatcgtcgccgacctcgcaccgaagaacaaggcgctgctcgccgtccgcgacgatctg
caggccaagatcgacacctggcaccgcgaccatcagggcgccgacttctccgacgccacc
accttcggtgagtacaaggatttcctcaccgagatcggctacctcgtgccggtgcccgac
gacttccagatcagcaccaccggcgtcgatcgcgagatcagcgagaccgcaggcccacag
ctggtggtgccggtcctcaacgcccgcttcgcgctcaatgcctccaacgcccgctggggt
tcgctgtacgacgccctctacggcaccgacgtcatcccggagaccgacggcgcggagaag
ggcaagtcctacaacaaggttcgcggcgacaaggtcatcgcgtacgcaaaggacttcctg
gacaaggcagttccgctcgaacaatgcagctacaccgacgtgaccgcgttcaccgtcgac
aacggcgcgctgtcggtgaccctggccgacggatcgacggccaccctcgccgacccgtcg
gcgttcgccggttatcgcggacaggcttcctcgccgtcgtcgatcctgttgcgccacaac
ggcctctacctcgacatcgagatcgacccgaactcccccatcggctccaccgacccggcg
ggcatcaaggacgtggtcatggagtcggcgatcaccacgatcatggacttcgaggactcc
gtcgccgcggtcgacgccgacgacaaggtgctcggctaccgcaactggctcggcctgaac
aagggcgacctggccgaagaggtgaccaagggcggcaagagcttcacccgccgcctcaat
cccaaccgcgagtacaccggacccgacgggaccggcttcgacctgcacggccgctcgctg
ctgttcgtccgcaacgtcggtcacctgatgaccaaccccgcgatcctcgacgccgacggc
aacgaggtccccgagggcatcctcgacgccctggtcacctcgctggccgccatccacgga
ctgtccacccactcgggtgtgcagaactcccggaccgggtccatctacatcgtcaagccg
aagatgcatgggcccgacgaggtcgccttcaccgtcgagttgttcggtcgcgtcgagcag
gtcctcggcctgccggagaacaccctcaaggtcggcatcatggacgaggagcgccgcacc
acggtgaacctcaaggccgcgatcaaggccgccgagaagcgggtggtgttcatcaacacc
ggcttcctcgaccgcaccggcgacgagatccacacctcgatggaggccggcgccatgatc
cgcaagggcgagatgaagaagcagaagtggattctcgcctacgaggacttcaacgtcgac
accggtttggccgccggcctgcagcacaaggcgcagatcggcaagggcatgtgggcgatg
accgatctgatggccgacatggtcgagcagaagatcggccagcccaaggccggcgcgacg
accgcgtgggtgccctcaccgacggcggcgacgctgcacgccatgcactaccacctcgtc
gacgtcttcgagcgccaggatgagatcgccaagcgggatccggcctcggtcgatgacatc
ctcaccatcccgctcgccccgaggaccgattggtccgacgaggagaagcgcgaggagctc
gacaacaactgccagtccatcctcggctacgtggtgcggtggatcgaccacggtgtcggc
tgctccaaggtccccgacatccacgacatcgcactgatggaagaccgtgcgacgctgcgc
atctcgagtcagctcctcgccaactggattcggcacggcatcgtgaccgccgacgacgtg
gtcgacgcgctcaagcggatggccccggtggtcgaccgacagaacgagggcgacccggat
taccggccgatggccccggacttcgacagcaacatcgcctggcaggccgccaaggagctg
atcctggagggcaccacccagcccagtggctacaccgagccgatcctgcatcgccgccgc
cgcgagtacaaagcggctgctcagggctga

DBGET integrated database retrieval system