KEGG   Gordonia polyisoprenivorans: GPOL_174p01010Help
Entry
GPOL_174p01010    CDS       T01719                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain RecD (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gpo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p174:100256..102364
Genome map
AA seq 702 aa AA seqDB search
MTPPTPPDTVAPVDDPAGPGAHTDDGRRVHGARGLLGEANAVGILDAADVHVATRLVRMC
GEPVSEIAEFAAALAVRAVRLGSTCLAVRDLADIAAGAEHDSAPERRAIGVGGAVGVGGA
VGADGRAVMPALPSADELVGGLRSSPLVVGAKGGPLRPLVVADTVDGPLIYLRKYFQQEQ
VIRTVLAERAASVPEVSAERVTGALDEVFGEGAGLAPRQRLAAAVAASRWTSVLTGGPGT
GKTYTVARILAVLDRLVPARLHIAVCAPTGRAVAQLQASLDGMSRGLGPDSSVTGDSASG
PPVHAVTVHGLLGWRPGSRPRYGPGNRLPHDVVVVDETSMLSVTAMSHLLEAVRPDARLI
LVGDPHQLASVEAGAVLADLVERPPSGARDSSGATDSSGATDSSGATHSSGADHDSGTAL
DAEIMALADDSRITASERPRLADGIVELTRNFRNRDGIATVAAAVNDGDGDRVLELIGSG
ELADIVLVEPDDPAIHRDVVAWVTDLWSAARAGDAPTALQVLDSHRVLCAHRAGRWGVQG
WTRQIVEWCGEIPGHPPVTPDLAAPQPGMPILVTANDRQNRVFNGDCGVVIAEAGDPSLT
VAFRRSEFSDPMFVPPARLAETMWAYAMTIHRSQGSQFDAVTVVLPPPDSPLLTRELLYT
AITRAKSRVRIVGTPETLRAAVGRRVHRASGLRSSPAEPAGR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgcccacaccaccggacaccgtcgccccggtcgacgatcccgccggccccggt
gcccacaccgatgacggcaggcgggtgcacggggcccgcgggctgctcggtgaggccaac
gccgtcggcatcctcgacgccgccgacgtgcacgtcgcgacccgactggtccgcatgtgc
ggggaaccggtgtccgagatcgccgagttcgccgcagcgctggccgtgcgcgcggtgcgc
ctgggctcgacctgcctggcggtccgcgacctggccgacatcgccgcgggcgcagaacac
gactccgcgccggagcgcagggccatcggagtgggcggtgccgtcggggtgggcggtgcc
gtcggggcggacggccgagcggtgatgccggcactgccgtccgccgacgaactcgtcggc
gggttgcgctcgagtccgctggtcgtcggtgccaagggcggccccctgcggccgctggtc
gtcgccgacaccgtcgacgggccattgatatacctgcgcaagtactttcagcaggagcag
gtgatccgcaccgtcctcgccgaacgagccgcgtcggtgcccgaggtctcggccgagcgg
gtcaccggtgccctcgacgaggtcttcggcgagggcgccggccttgcacctcgacagcgg
ctggccgccgccgtcgccgcctcgcggtggacctcggtgctcaccggaggtccgggtacc
ggcaagacctacaccgttgcgcgcatcctcgccgtgctcgatcggctcgtcccggcacgc
ctgcacatcgcggtgtgcgcacccacgggccgcgcggtcgcccagctgcaggcctcactc
gacgggatgagccgcgggctcggcccggactcgtcggtcacgggcgactcggcaagcggc
ccaccggtacacgcggtgaccgttcacggactgttgggctggcgacccggttcgcggccg
cgctatggaccgggtaaccgcttgccgcacgacgtggtggtcgtcgacgagacctccatg
ctgtcggtgaccgcgatgagtcacctcctcgaggcggtgcgtccggatgcgcgcctgatc
ctggtgggtgatccccatcagctcgcgtcggtggaggccggtgcggtgctcgccgacctc
gtcgagcggccacccagcggcgcaagagactccagcggcgcaacagactccagcggcgca
acagactccagcggcgcaacacactccagcggcgcagatcacgacagtgggaccgcactc
gatgccgagatcatggccctggcggacgactcgcggatcaccgcatccgaacgtccgcgt
ttggccgatggcatcgtcgaactgacccgcaacttccgcaaccgcgacggcatcgccacg
gtcgccgcagcggtcaatgacggtgacggcgatcgcgtgctcgagctcatcggctccggc
gagctggccgacatcgtgctcgtcgagcccgacgatcccgcgatccaccgcgacgtcgtc
gcctgggtcaccgatctgtggtcggcagcccgcgccggcgatgcgccgaccgcgttgcag
gtgctcgattcacaccgcgtgttgtgtgcccaccgtgcgggccggtggggtgtgcagggg
tggacgcgtcagatcgtcgagtggtgcggtgagatccccggccacccgcctgtgacgccc
gacctcgcggcgccacagcccgggatgccgatcctggtgaccgccaacgatcggcagaac
cgggtgttcaacggggactgcggtgtggtgatcgccgaggccggcgatccgtcgctgacc
gttgccttccggcgcagcgagttcagcgatccgatgttcgtcccgccggcgcggctggcc
gagacgatgtgggcctacgcgatgaccatccaccgcagccagggcagccagttcgatgcg
gtcaccgtcgttctgccaccgccggattcgccgctgctcacccgggaactcctctatacc
gccatcacccgcgccaagtcgcgggttcggatcgtcggaaccccggagacgttacgggcg
gcggttggtcgtcgcgtgcaccgcgcgagcggactgcgctcctccccggcggagccggcg
ggtcgatga

DBGET integrated database retrieval system