KEGG   Gordonia polyisoprenivorans: GPOL_c01210Help
Entry
GPOL_c01210       CDS       T01719                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GPOL_c01210
Enzymes [BR:gpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     GPOL_c01210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(134493..135995)
Genome map
AA seq 500 aa AA seqDB search
MRNTVHLIAYADRFGGSLAGLTALLRGPFDGVFGGVHVLPFFTPFDGADAGFDPVDHTRV
DPRLGSWADITDLATTHEVMADQIINHVSADSAQFRDVVAHGDESGYAPMFLTLSSVFPN
GATEDQLTAIYRPRPGLPFTAIALGGRVRYVWTTFTAAQIDIDVRSAPGGAYLDSILDAA
TDAGVSALRLDAVGYAIKTPGTSCFMTPETIAFIDEFAAKAHTRGVEVLVEVHSHFARQI
AIARSVDRVYDFALPALVLHTLYTADAQALVRWLQIRPDNAVTVLDTHDGIGVVDVGPDP
VEGPGLLTPVQVHELVEEIHRRTGGTSRLATGTSAANVDIYQVNSTFYDALGRDDERYLS
ARTLQLFVPGIPQVYYVGLLAGGNDMELLDRTGVGRDINRHHYTHAEIAEDLRRPVVGAL
LALCRFRNTHPAFDGPCETTLADGHLRLLRRGRAVAGAWARADIDLATGVTQLAWGDGDR
EWSAPVAELANRWGVSSEVS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaacacggtgcatctgattgcgtacgcggatcggttcggcggcagcctcgccggc
ctcaccgcactcctgcgaggccccttcgacggtgtgttcggcggggtgcatgtgctgccg
ttcttcaccccgttcgacggtgccgacgccggattcgaccccgtcgaccacacccgcgtc
gacccccggctggggagctgggccgacatcaccgacctcgcgaccacgcacgaggtgatg
gccgatcagatcatcaaccacgtgtcggcggactcggcacagtttcgtgacgtcgtcgcc
cacggcgacgagtcgggctatgcgccaatgtttctcaccttgtcgtcggtgttcccgaac
ggcgccaccgaggaccagctgacggccatctaccggccgcggcccgggttgccgttcacg
gccatcgcgctcggcgggcgtgtgcggtacgtgtggaccaccttcaccgccgcccagatc
gacatcgacgtgcggtcggcgccgggcggggcttacctcgactcgatcctcgacgcggcc
accgatgccggggtgagcgcgctacgtctcgacgccgtcgggtatgcgatcaagacaccg
ggaacctcgtgtttcatgacacccgagaccatcgccttcatcgacgagttcgcggcgaag
gcgcacacgcggggtgtcgaggtcctcgtcgaggtgcactcgcatttcgcgcggcagatc
gccatcgcgcgctcggtcgaccgcgtctacgacttcgctctgcccgcattggtgttgcat
accctctacaccgccgatgcgcaggcgctggttcggtggctgcagatccgccccgacaac
gccgtcaccgtcctcgacacccacgatggcatcggggtcgtcgacgtcggacccgacccg
gtcgaaggtccagggctgctcacccccgtgcaggttcacgagctcgtcgaggagatccac
cggcgcaccggcgggacgagtcgcctcgccacgggcacatcggcagcgaacgtcgatatc
tatcaggtgaattcgacgttctacgatgcgctcggccgtgacgacgagcgctatctgagc
gcccgcacgctgcagttgttcgtgccgggcatcccgcaggtctactacgtcgggctgctg
gccggcggcaacgacatggagttgctcgatcggaccggcgttggccgcgacatcaatcgt
caccactacacgcatgccgagatcgccgaggacctccgccgcccggtggtcggggcgctg
ctggcgttgtgccggttccgcaacacccatccggcgttcgacgggccgtgtgagaccaca
ctcgccgacgggcatctgcggttgctgcggcgcggacgtgcggtggcgggggcatgggcg
cgcgccgacatcgatctcgcgaccggtgtcacccagctggcctggggcgacggcgatcgc
gagtggtcggcgcccgtcgccgagctagcgaacaggtggggcgtgtcgtccgaggtgagc
tga

DBGET integrated database retrieval system