KEGG   Gordonia polyisoprenivorans: GPOL_c02530Help
Entry
GPOL_c02530       CDS       T01719                                 

Gene name
acsA1
Definition
acetyl-coenzyme A synthetase AcsA (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gpo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gpo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gpo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gpo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:gpo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(301477..303072)
Genome map
AA seq 531 aa AA seqDB search
MTQTAPAHPSAEAEVAALLAEFGANDANAATLLVDRHDPDAVAFMTVGTSGDDLVTTRIT
YGDLAAQSRKFATALAGLGVERGSRVGVLMGKRVELVVTLLALARLGAVYIPLFTAFATP
AIEMRLRGGDADIVVTEASQVDKLDGIEGLTTVVAGAGSPAESGSGTHDFDTLLAASEPW
EDSVAVGGDGHLILLFTSGTTGAPKGVPVPVRALAAFVTYMRFGLDVTDDDVFWNAADPG
WAYGLYYGILGPLATRRPNILLQAGFTPELTARILGELGVTNFAAAPTVYRALSKSGAIE
GFSLRHASSAGEPLTPDVIDWATGALGTEVRDHYGQTEHGMFINNHWAPEVRRPLIPGSM
GQPMPGFATDIVDGQIAIDVSASPALWFTGYLDDPEKTAARFTEDGRWYLTGDTGRVDEN
GNYYFSARDDDVIIMAGYRIGPFDVESVLITHPSVIDVAVVGRPDELRGEVLEAFVVLAD
GVVGDDALEAELQQLVKTGFAAHAYPRSVHFVDALPKTPSGKIQRFVLRQR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccgctcccgcgcatccctccgccgaggccgaggtggccgcgttgctggcc
gagttcggcgcgaacgacgcgaatgccgcgaccctgctcgtcgaccggcacgacccggat
gccgtcgccttcatgacggtcggcaccagcggcgacgacctcgtcacgacccgcatcacc
tacggcgacctggccgctcagtcacggaagttcgcgaccgccctggccgggctcggcgtc
gagcgcggttcgcgggtcggcgtgttgatgggcaagcgcgtcgagctggtggtcacgttg
ctggcactcgcccgcctcggcgccgtctacatcccgctgttcacggcgttcgcgacaccg
gcgatcgagatgcggctacgtggaggcgacgccgacatcgtggtgaccgaggcgagtcag
gtcgacaaactcgacggaatcgagggcctgaccacggtggtcgccggtgccgggagtccg
gccgagagcgggtcgggcacccacgatttcgacaccctgctcgccgcgagtgagccctgg
gaggattcggtggccgtcggcggcgacgggcacctgatcctgctgttcaccagcggaacc
acgggcgcgcccaagggggttccggtgccggtgcgcgcactggcggcgttcgtcacgtac
atgcgtttcggtctcgacgtgaccgacgacgacgtgttctggaatgccgccgacccgggc
tgggcctacggcctgtattacggcatcctcggtccgctggccaccagacgcccgaacatc
ttgctgcaggccggtttcacgccggagctgaccgctcgcattctcggcgagcttggcgtc
accaacttcgccgccgccccgacggtatatcgcgcgctgagcaaaagcggtgcgatcgag
ggcttttcgctacggcatgcgtcgtcggcgggcgagccgctgacgccggatgtgatcgat
tgggcgacaggcgcattgggaaccgaggtgcgcgaccactacggccagaccgaacacggc
atgttcatcaacaaccactgggccccggaagtgcggagaccgctgatccccggatcgatg
ggccaaccgatgcccggtttcgccaccgacatcgtcgacggacagatcgcgatcgacgta
tcggccagtccggcactgtggttcaccggctacctcgacgacccggagaagaccgcggcc
cggttcaccgaggacgggcgctggtatctgaccggcgatacgggccgggtagacgaaaac
ggcaattactacttcagtgctcgggacgacgacgtgatcatcatggccggctaccggatc
ggaccattcgacgtcgagagcgtgctgatcacccatccgtcggtgatcgacgtcgccgtc
gtcggccggccggacgagctgcgtggtgaggtcctcgaggccttcgtcgtgctcgccgac
ggtgtggtcggcgacgacgccctggaggccgaactgcagcagctggtcaagacgggtttc
gccgcgcatgcctatccgcgcagcgtgcatttcgtcgacgcgctgcccaagacaccgagc
ggcaagatccagcggttcgtcctgcggcagaggtag

DBGET integrated database retrieval system