KEGG   Gordonia polyisoprenivorans: GPOL_c05470Help
Entry
GPOL_c05470       CDS       T01719                                 

Definition
putative fatty acid oxidation complex alpha-subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c05470
   01212 Fatty acid metabolism
    GPOL_c05470
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GPOL_c05470
   00650 Butanoate metabolism
    GPOL_c05470
  Lipid metabolism
   00071 Fatty acid degradation
    GPOL_c05470
   01040 Biosynthesis of unsaturated fatty acids
    GPOL_c05470
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GPOL_c05470
   00310 Lysine degradation
    GPOL_c05470
   00380 Tryptophan metabolism
    GPOL_c05470
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GPOL_c05470
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GPOL_c05470
   00281 Geraniol degradation
    GPOL_c05470
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    GPOL_c05470
Enzymes [BR:gpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     GPOL_c05470
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GPOL_c05470
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     GPOL_c05470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643882..646041
Genome map
AA seq 719 aa AA seqDB search
MINWEKDADGVVILTMDDKSQGANTMNQTFMDSIAATVDRLEAEKDDITGVVITSAKKTF
FAGGDLKDMTAEQTQTKEEIATAITERTNGMKKVLRRLETLGKPVVAAINGAALGGGLEL
ALHTHHRIAADIKGVQIGLPEVTLGLLPGGGGVVRTVRLLGFQAALMNVLLQGPRFNAAK
AKETGLVDELVGSVEELVPAAKEWIKANPEAVQPWDVKGYKMPGGAVTNPSVAANLPAFP
AILRKQIKGANMPAPRAILAAAIEGAYVDVDTADIIETRYFVSLVTGQVAQNMIKAFFFD
LQHINNGGSRPEGYDKYTAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDIEAAKRGKG
YSEKLEEKALSRGKTTQEKSDALLARITPTVDAADFKGVDLVIEAAFESVEVKNKVFQEI
EDIVEPDAVLGSNTSTLPITILAQGVKRQEDFIGIHFFSPVDKMPLVEIIRGEKTSDAVL
AKVIDYTLQIRKTPIVVNDSRGFFTSRVIGTFINEAIAAVGEGVEPALVEHAGTQAGYPA
APLQLSDELNLILMQKIRKESQAAAEAEGKEFPQHGSFAVIDYLVEQGRPGKKEGAGFYE
YDENGKRVRLWPGLREKFNSGSSQQSLEDLKERMLFAEAVETARCIEEGVITSVPDANIG
SIFGIGFPAWTGGVVQYMNQYEGGLAGFVERSRELAKKYGAQFEPPASLVEKANKGEKY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattgggagaaggatgccgacggcgtcgtcatcctgaccatggacgacaagagc
cagggcgccaacaccatgaaccagacgttcatggactcgattgccgccacggtcgatcgt
ctcgaggcggagaaggacgacatcaccggtgtcgtcatcacctcggcgaagaagaccttc
ttcgccggcggcgacctcaaggacatgaccgccgagcagacccagaccaaagaggagatc
gccaccgcgatcaccgagcgcaccaacggcatgaagaaggtgctgcgtcggctcgagacc
ctcggcaagccggtcgtcgccgccatcaacggtgccgcactcggtggcggcctcgagctc
gcgctgcacacccaccaccgcatcgccgcggacatcaagggtgtccagatcggtctgccc
gaggtcaccctcggcctgctgcccggtggcggtggcgtcgtgcgtaccgtgcgtctgctc
ggcttccaggccgcgctgatgaacgtgctcctgcagggcccgcggttcaacgccgccaag
gccaaggagaccggtctggtcgacgagctcgtcggctcggtcgaagaactcgtgccggcc
gccaaggaatggatcaaggccaaccccgaagcggtccagccgtgggatgtcaagggctac
aagatgcccggtggtgcggtcaccaatccgtcggtcgcggccaacctgcccgccttcccg
gcgatcctgcgcaagcagatcaagggcgccaacatgccggctccgcgcgccatcctggcc
gcggccatcgagggcgcctacgtcgacgtcgacaccgccgacatcatcgagacccgctac
ttcgtgtcgctggtgaccggtcaggtcgcgcagaacatgatcaaggcgttcttcttcgac
ctgcagcacatcaacaacggtggctcgcggccggaaggctatgacaagtacaccgccaag
aaggtcggcgtcatcggcgcgggcatgatgggtgcggcgatcgcctacgtctcggccaag
gccggcatcgaggtcgtcctcaaggacatcgacatcgaggccgccaagcggggcaagggc
tactcggagaagctcgaggagaaggcgctctcgcggggcaagaccacccaggagaagagt
gacgcgctgctcgcgcggatcacgccgaccgtcgacgccgccgatttcaagggtgtcgac
ctcgtcatcgaggccgccttcgagtcggtcgaggtgaagaacaaggtgttccaggagatc
gaggacatcgtcgagcccgacgccgtgctcggctcgaacacctcgacgctgccgatcacg
atcctcgcccagggcgtcaagcgccaggaggacttcatcggtatccacttcttctcgccg
gtcgacaagatgccgctggtggagatcatccgtggtgagaagacctcggatgcggtgctg
gccaaggtgatcgactacaccctgcagatccgcaagaccccgatcgtggtcaacgacagc
cgcgggttcttcaccagccgggtcatcggcaccttcatcaacgaggccatcgcggccgtc
ggcgaaggtgtggaaccggcactggtcgagcacgccggcacccaggccggatacccggcc
gcaccgctgcagctgtccgatgagctgaatctcatcctgatgcagaagatccgtaaggaa
tcccaggctgccgccgaggcggagggcaaggaattcccgcagcacggatcgttcgccgtc
atcgattacctcgtcgagcagggccgtcccggcaagaaggaaggcgccggcttctacgag
tacgacgagaacggcaagcgcgtgcggctgtggccgggtctgcgggagaagttcaactcc
ggaagcagccagcagtcgctcgaggacctcaaggagcgcatgctcttcgccgaggccgtc
gagaccgcgcgctgcatcgaggaaggtgtcatcacctcggtgcccgacgccaacatcggc
tcgatcttcggcatcggcttcccggcctggaccggcggtgtggtgcagtacatgaaccag
tacgaaggcggcctggccggcttcgtcgaacgctcgcgcgaactggccaagaagtacggc
gcgcagttcgagccgccggcctcgctggtggagaaggcgaacaagggcgagaagtactga

DBGET integrated database retrieval system