KEGG   Gordonia polyisoprenivorans: GPOL_c05880Help
Entry
GPOL_c05880       CDS       T01719                                 

Definition
putative glycoside hydrolase, family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gpo00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gpo00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699901..701049
Genome map
AA seq 382 aa AA seqDB search
MTSVAVVGCGTDSSSSAAQTSSSAPSSASTRSSPPASTSAAVPIGCGAATLAKMSLRQKL
GQSIVVGVTGTDDALSLVKREPVGGIFIGSWTDKSLLTDQGALEKVTAASSIPLMVSVDQ
EGGRVSRLSSLGIDSPSARELARTKTPEQVRALAASEGKKMRALGITVDFAPDADVSDEP
DDAVIGDRSFSDDPATVARYAQAFAEGLQSAGVMPVFKHFPGHGHGSGDSHLGVVRTPPL
TQLERSDLVPYKTLLANPGNAAVMVGHLIVPGLTVGDTPASLSVNAMRMLRTGQPYGGPA
FDGVVFSDDLSGMGAITQRYPLPQAVQRFLVAGGDIALWITTDKVTAVLNSLESAVRSGQ
LSQSRVDESVVRILKAKGQLRC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagtgtcgccgtggtcggctgcggcaccgattcctcctcgtcggccgcgcagaca
tcgtcgagcgcgccctcgtcggcgtcgacccgctcgtccccgccggcgtcgacgagtgcc
gcggtgcccatcggctgcggtgcggcgacgctggcgaagatgtcgctgcgacagaagttg
ggccagtcgatcgtcgtcggcgtgaccggaaccgacgacgcgctgtcgttggtcaaacgg
gagccggtgggcggcatcttcatcggcagttggaccgacaaatcgcttctcaccgaccag
ggcgccctcgagaaggtcaccgcagcctcgtcgatcccgctgatggtcagcgtcgaccag
gaaggcggtcgcgtctcccggttgtcctcgctcggtatcgacagcccgtcggcgcgtgag
ctcgcgcgcaccaagacacccgagcaggtccgtgccctcgcggcgagtgagggcaagaag
atgcgggcgttgggtatcaccgtggacttcgcccccgacgccgacgtcagcgacgaaccc
gacgacgcggtcatcggtgaccgctcgttctccgacgacccggccacggtggcccgatac
gcccaggcgttcgccgagggacttcaatccgccggagtcatgccggtgttcaaacacttc
ccggggcacgggcacggttcgggtgactcccacctcggtgtcgtgcgcacgccgccgctc
acgcaactcgagcgcagcgacctcgtcccgtacaagacgctgctggcgaatccggggaat
gcggcggtgatggtcgggcatctgatcgtgcccggactgaccgtcggtgacacgccggcg
agcctgagcgtcaacgccatgcgcatgctgcggaccgggcaaccgtacggcggtccggcc
ttcgacggtgtggtcttctccgacgacctgtccgggatgggcgccatcacccagcgctac
ccgctgccgcaggcggtgcaacgcttcctcgtcgccggcggcgacatcgccctgtggatc
accaccgacaaggtgaccgccgtcctcaatagcctcgagtccgccgtccggtccggacaa
ctgagtcagtcgcgcgtcgacgagtcggtcgtccgcatcctcaaagccaaggggcagcta
cggtgctga

DBGET integrated database retrieval system