KEGG   Gordonia polyisoprenivorans: GPOL_c10270Help
Entry
GPOL_c10270       CDS       T01719                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GPOL_c10270 (gpmA)
   01230 Biosynthesis of amino acids
    GPOL_c10270 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GPOL_c10270 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    GPOL_c10270 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GPOL_c10270 (gpmA)
Enzymes [BR:gpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GPOL_c10270 (gpmA)
Exosome [BR:gpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GPOL_c10270 (gpmA)
  Exosomal proteins of melanoma cells
   GPOL_c10270 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184425..1185171
Genome map
AA seq 248 aa AA seqDB search
MSNGTLILMRHGESEWNASNQFTGWVDVALTDKGEAEAKRAGELLAEHDLLPDVLYTSLL
RRAIATAQIALDTADRHWIPVVRDWRLNERHYGALQGLNKADTLEKYGKEQFMLWRRSYD
TPPPPIDPDAEYSQTHDPRYADLAEVPLTECLKDVVERLIPYFTETIAADITAGKTVLIA
AHGNSLRALVKYLDGISDADIAGLNIPTGNPLRYDLDENLKPLNPGGTYLDPEAAAAGAA
AVAAQGQK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggcaccctgatcctgatgcggcacggcgagagcgagtggaacgcgtccaac
cagttcaccggctgggtcgacgtcgcgctcaccgacaagggcgaggccgaggcgaagcgg
gccggcgagctcctcgccgaacatgatctgctgcccgatgtcctctacacctcactactg
cgccgggcgattgcgaccgcgcagatcgcgttggacaccgccgatcggcactggatcccg
gtggtccgcgactggcgtctcaacgaacgtcactacggtgcgctgcagggcctgaacaag
gccgacacccttgagaagtacggcaaggagcagttcatgctttggcgtcgcagctacgac
accccgccgccgccgatcgatcccgacgccgagtacagccagacccacgatccgcggtac
gccgatctcgccgaggtgccgctgaccgaatgcctcaaggacgtcgtcgagcggctgatc
ccgtatttcaccgagaccattgccgccgacatcaccgccggcaagaccgttctcattgcg
gcgcacggtaattcgctgcgcgcactggtcaagtacctcgacgggatctccgacgccgac
atcgccggtctcaacatcccgacgggcaatccgctgcgttacgacctcgacgagaacctc
aagccgctcaatcccgggggcacttatctggaccctgaggccgccgcggcgggtgcggca
gcggtcgctgcgcagggacagaaatag

DBGET integrated database retrieval system