KEGG   Gordonia polyisoprenivorans: GPOL_c12200Help
Entry
GPOL_c12200       CDS       T01719                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GPOL_c12200
Enzymes [BR:gpo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     GPOL_c12200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1409706..1411175
Genome map
AA seq 489 aa AA seqDB search
MDEVAEDFTSGDFTTDAPTGGSTTTETRHPSPRTLGELRASGHVQRSIRDEIRNNLLTAL
REGRDPWPGIVGFEATVIPQLERALLAGHDVVMLGERGQGKTRILRTLVGLLDEWTPVIA
GSELGEHPYEPITPASIRKAANLLDDLPIEWRHRNERYSEKLATPDTSVADLVGDIDPMK
VAEGRSLGDPETIHFGLIPRAHRGIVAINELPDLAERIQVSMLNVMEERDIQVRGYTLRL
PLDVLVMASANPEDYTNRGRIITPLKDRFGAEIRTHYPIELDDEVAVIEQEADLTATVPT
FITEILARFTRYARDHPSIDQRSGVSARFSIAGAETVAAAALHRAAVTGEEVPVARVVDL
ESVIEVLRGKIEFESGEEGRELEILEHLMRKSVADTVRAHLGGIDMAPLVSALDAGELVV
TGDRVPAADFLDSLPSPETTAPVIDEIAERLEAGSDGERASAVELALEGLFLARRIGKEA
DESGQTIYG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaggtggcagaagacttcacatccggggatttcacgaccgacgccccgaccggc
ggttcaacgaccaccgaaacccgtcatccttctcctcgcacccttggtgaactgcgtgca
agcggtcatgtgcagcgcagcatccgcgacgagatccgtaacaacctgctgaccgcgctg
cgcgagggccgcgatccgtggccgggcattgtcgggttcgaggcgacggtcatcccgcag
ctcgaacgtgcactgctcgccggacacgacgtcgtcatgctcggcgaacgcggccagggc
aagacccgcatcctgcggaccctcgtcggccttctcgacgagtggacgcccgtgatcgcc
ggctccgaactcggcgagcatccctacgagccgatcaccccggcatcgatccgcaaggcc
gccaacctcctcgacgacctgcccatcgaatggcgtcaccgcaatgagcgctacagcgag
aagctcgccacgccggacacctcggtggccgacctcgtcggcgacatcgacccgatgaag
gtcgccgaagggcgcagcctcggtgacccggagaccatccacttcgggctcatcccgcgg
gcacatcgcggcatcgtcgccatcaacgagctccccgacctggccgaacgcatccaggtc
tcgatgctcaacgtgatggaggaacgcgacatccaggtccgcggctacacgctgcgcctg
ccgctggacgtgctcgtgatggccagcgccaaccccgaggactacaccaaccgcgggcgc
atcatcaccccgctcaaggaccgcttcggcgccgagatccgcacgcactacccgatcgaa
ctcgacgacgaggtcgccgtcatcgagcaggaggccgacctcaccgccacggtcccgacc
ttcatcaccgagatcctcgcgcggttcacccgctacgcccgcgaccacccgtcgatcgat
cagcgttcgggtgtgtcggcgcggttctcgatcgccggcgccgagaccgttgccgcggcg
gcgctgcaccgcgcggccgtcaccggcgaagaggtgccggtggcgcgcgtcgtcgatctg
gaatcggtgatcgaggtgctgcgcggcaagatcgagttcgagtccggcgaagagggacgt
gaactcgagatcctcgagcacctgatgcgcaagtccgtcgccgacacggtgcgtgcccac
ctcggcggcatcgacatggcgccgctggtgtcggcattggacgccggcgagctcgtggtc
accggtgaccgggtgcccgccgcggacttcctcgactcgctgccgtcgccggagaccacc
gcgccggtgatcgacgagatcgccgagcgactcgaggccggctccgacggcgaacgggcc
agcgccgtcgaactcgccctcgagggactgttcctcgcgcgacgcatcggcaaggaagcc
gacgagtcggggcagacgatctacggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system