KEGG   Gordonia polyisoprenivorans: GPOL_c12200Help
Entry
GPOL_c12200       CDS       T01719                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gpo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1409706..1411175
Genome map
AA seq 489 aa AA seqDB search
MDEVAEDFTSGDFTTDAPTGGSTTTETRHPSPRTLGELRASGHVQRSIRDEIRNNLLTAL
REGRDPWPGIVGFEATVIPQLERALLAGHDVVMLGERGQGKTRILRTLVGLLDEWTPVIA
GSELGEHPYEPITPASIRKAANLLDDLPIEWRHRNERYSEKLATPDTSVADLVGDIDPMK
VAEGRSLGDPETIHFGLIPRAHRGIVAINELPDLAERIQVSMLNVMEERDIQVRGYTLRL
PLDVLVMASANPEDYTNRGRIITPLKDRFGAEIRTHYPIELDDEVAVIEQEADLTATVPT
FITEILARFTRYARDHPSIDQRSGVSARFSIAGAETVAAAALHRAAVTGEEVPVARVVDL
ESVIEVLRGKIEFESGEEGRELEILEHLMRKSVADTVRAHLGGIDMAPLVSALDAGELVV
TGDRVPAADFLDSLPSPETTAPVIDEIAERLEAGSDGERASAVELALEGLFLARRIGKEA
DESGQTIYG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaggtggcagaagacttcacatccggggatttcacgaccgacgccccgaccggc
ggttcaacgaccaccgaaacccgtcatccttctcctcgcacccttggtgaactgcgtgca
agcggtcatgtgcagcgcagcatccgcgacgagatccgtaacaacctgctgaccgcgctg
cgcgagggccgcgatccgtggccgggcattgtcgggttcgaggcgacggtcatcccgcag
ctcgaacgtgcactgctcgccggacacgacgtcgtcatgctcggcgaacgcggccagggc
aagacccgcatcctgcggaccctcgtcggccttctcgacgagtggacgcccgtgatcgcc
ggctccgaactcggcgagcatccctacgagccgatcaccccggcatcgatccgcaaggcc
gccaacctcctcgacgacctgcccatcgaatggcgtcaccgcaatgagcgctacagcgag
aagctcgccacgccggacacctcggtggccgacctcgtcggcgacatcgacccgatgaag
gtcgccgaagggcgcagcctcggtgacccggagaccatccacttcgggctcatcccgcgg
gcacatcgcggcatcgtcgccatcaacgagctccccgacctggccgaacgcatccaggtc
tcgatgctcaacgtgatggaggaacgcgacatccaggtccgcggctacacgctgcgcctg
ccgctggacgtgctcgtgatggccagcgccaaccccgaggactacaccaaccgcgggcgc
atcatcaccccgctcaaggaccgcttcggcgccgagatccgcacgcactacccgatcgaa
ctcgacgacgaggtcgccgtcatcgagcaggaggccgacctcaccgccacggtcccgacc
ttcatcaccgagatcctcgcgcggttcacccgctacgcccgcgaccacccgtcgatcgat
cagcgttcgggtgtgtcggcgcggttctcgatcgccggcgccgagaccgttgccgcggcg
gcgctgcaccgcgcggccgtcaccggcgaagaggtgccggtggcgcgcgtcgtcgatctg
gaatcggtgatcgaggtgctgcgcggcaagatcgagttcgagtccggcgaagagggacgt
gaactcgagatcctcgagcacctgatgcgcaagtccgtcgccgacacggtgcgtgcccac
ctcggcggcatcgacatggcgccgctggtgtcggcattggacgccggcgagctcgtggtc
accggtgaccgggtgcccgccgcggacttcctcgactcgctgccgtcgccggagaccacc
gcgccggtgatcgacgagatcgccgagcgactcgaggccggctccgacggcgaacgggcc
agcgccgtcgaactcgccctcgagggactgttcctcgcgcgacgcatcggcaaggaagcc
gacgagtcggggcagacgatctacggctga

DBGET integrated database retrieval system