KEGG   Gordonia polyisoprenivorans: GPOL_c12500Help
Entry
GPOL_c12500       CDS       T01719                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GPOL_c12500
   00052 Galactose metabolism
    GPOL_c12500
   00500 Starch and sucrose metabolism
    GPOL_c12500
   00520 Amino sugar and nucleotide sugar metabolism
    GPOL_c12500
Enzymes [BR:gpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GPOL_c12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1447866..1448816
Genome map
AA seq 316 aa AA seqDB search
MTSVSNSTTEIPEYHDVPDTPPIPRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIEL
VAEEAKSAGAERLLIITSPGKDGVVAHFVEDLVLENTLAKRGKAAMLAKVRKAPSLLDVA
SVIQDKPLGLGHAVGCVEDYLDDDEDAIAVLLPDDLVLPGGVLEVMARTRQRRGGSVLCA
IEVPGDRISAYGVFDVEDLPDANNPNVKRLKGMVEKPAPEEAPSNLAAAGRYILDRKIFD
ALRRIKPGAGGELQLTDAIALLIEEGEPVHVVVHHGTRHDLGNPGGYLKAAVDFALDRDD
YGPDLREWLTERLKQD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgtgagtaattcgacgaccgagattcccgagtaccacgacgtacccgacacc
ccgccgatcccacgtaccgcggtggtcccggccgcgggtctgggcacacgattcctgccg
gcgaccaagacggtgcccaaggagttgctgcccgtcgtcgatacccccggcatcgaactc
gtcgccgaggaggccaagtccgccggtgccgaacggctgctgatcatcacctcacccggc
aaggacggcgtggtcgcgcacttcgtcgaagacctggtgctggagaacacgctggccaag
cgcggcaaggcggcgatgctcgccaaggtccgcaaggcaccgtcgctgctggacgtggcc
tcggtgatccaggacaagccgctcggtctcggccatgccgtcggatgcgtcgaggactac
ctcgacgacgacgaggacgcgattgcggtgctgctgcccgacgatctggtgttgcccggt
ggggtgctcgaggtgatggcccgtacccgacaacgacgcggcggatcggtgctgtgtgcc
atcgaggtccccggcgaccggatcagtgcctacggcgtcttcgacgtcgaggacctgccc
gacgccaacaacccgaacgtcaagcgcctcaagggcatggtcgaaaagcccgcacccgag
gaggcgccgtcgaacctcgcggccgccggccgatacatcctcgaccgcaagatctttgac
gcgctgcgccgcatcaagcccggtgcgggtggcgaattgcagctgaccgacgcgatcgcc
ctgctcatcgaggaaggtgagccggtgcacgtggtcgtccatcacggcacccgtcacgac
ctcggcaaccccggcggctacctgaaagcggccgtcgacttcgccctcgaccgcgatgac
tacggtcccgacctgcgcgagtggctcaccgagcgcctcaagcaggactga

DBGET integrated database retrieval system