KEGG   Gordonia polyisoprenivorans: GPOL_c13670Help
Entry
GPOL_c13670       CDS       T01719                                 

Definition
putative limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
gpo  Gordonia polyisoprenivorans
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    GPOL_c13670
Enzymes [BR:gpo01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     GPOL_c13670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1564482..1564937
Genome map
AA seq 151 aa AA seqDB search
MTSRTPIDIVTGFLDGLARGDSATACLDLADAVVYTNVSLATIRGRRPVTKIFGSMDSSP
VSFDYRMVNVSSDDTVVLTERVDQISVGRLHVQFWVCGRFEVVDGQITVWRDYFDYFDIT
KAFLRGVVGVLVPAAVRPLNGRSKVGRALAE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgcactcccatcgacatcgtcaccggcttcctcgacgggctcgcgcgtggt
gacagcgccaccgcctgcctcgatctcgccgacgccgtcgtctacacgaacgtgtccctg
gcgaccattcgcgggcgcaggccggtcaccaagatcttcggttcgatggattcctcgccg
gtctccttcgactaccggatggtcaacgtgtcctccgacgacaccgtcgtgctgaccgaa
cgggtcgaccagatcagtgtcggccgattgcacgtgcagttctgggtgtgcgggcggttc
gaggtggtcgacggccagatcacggtgtggcgggactacttcgactacttcgacatcacc
aaggcttttctgcgcggagtggtcggggtgctcgtcccggcggctgtgcgtccgctgaac
ggtcgatcgaaggtcggacgtgccctcgccgagtga

DBGET integrated database retrieval system